Mouse anti-Human TMPRSS3 Monoclonal Antibody | anti-TMPRSS3 antibody

TMPRSS3 (Transmembrane Protease Serine 3, ECHOS1, Serine Protease TADG-12, Tumor-associated Differentially-expressed Gene 12 Protein, TADG12, UNQ323/PRO382, DFNB8, DFNB10) (HRP)

Cat. Num. AAA6155448

• Gene Names: TMPRSS3; DFNB8; DFNB10; ECHOS1; TADG12
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TMPRSS3; Monoclonal Antibody; TMPRSS3 (Transmembrane Protease Serine 3; ECHOS1; Serine Protease TADG-12; Tumor-associated Differentially-expressed Gene 12 Protein; TADG12; UNQ323/PRO382; DFNB8; DFNB10) (HRP); EC=3.4.21.-; anti-TMPRSS3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E1
• Specificity: Recognizes human TMPRSS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TMPRSS3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa119-215 from human TMPRSS3 (NP_076927) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Product Categories/Family for anti-TMPRSS3 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 13173471
• NCBI GeneID: 64699
• NCBI Accession #: NP_076927
• NCBI GenBank Nucleotide #: NM_024022
• UniProt Accession #: P57727
• Molecular Weight: 50kDa
• NCBI Official Full Name: transmembrane protease serine 3 isoform 1
• NCBI Official Synonym Full Names: transmembrane serine protease 3
• NCBI Official Symbol: TMPRSS3
• NCBI Official Synonym Symbols: DFNB8; DFNB10; ECHOS1; TADG12
• NCBI Protein Information: transmembrane protease serine 3
• UniProt Protein Name: Transmembrane protease serine 3
• Protein Family: Transmembrane protease serine
• UniProt Gene Name: TMPRSS3
• UniProt Synonym Gene Names: ECHOS1; TADG12
• UniProt Entry Name: TMPS3_HUMAN

NCBI Description

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, an LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor-associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]

Uniprot Description

TMPRSS3: Probable serine protease that play a role in hearing. Acts as a permissive factor for cochlear hair cells survival and activation at the onset of hearing and is required for saccular hair cell survival. Activates ENaC (in vitro). Defects in TMPRSS3 are the cause of deafness autosomal recessive type 8 (DFNB8). DFNA8 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Defects in TMPRSS3 are the cause of deafness autosomal recessive type 10 (DFNB10). Belongs to the peptidase S1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.-; Membrane protein, integral; Endoplasmic reticulum; Protease

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum membrane; cell soma; endoplasmic reticulum; integral to membrane

Molecular Function: sodium channel regulator activity; serine-type endopeptidase activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cellular sodium ion homeostasis; sensory perception of sound; proteolysis

Disease: Deafness, Autosomal Recessive 8