Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TM4SF4 expression in transfected 293T cell line by TM4SF4 monoclonal antibody (M03), clone 4E6.Lane 1: TM4SF4 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: Non-transfected lysate.)

Mouse TM4SF4 Monoclonal Antibody | anti-TM4SF4 antibody

TM4SF4 (Transmembrane 4 L six Family Member 4, FLJ31015, ILTMP, il-TMP) (APC)

Gene Names
TM4SF4; ILTMP; il-TMP
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TM4SF4; Monoclonal Antibody; TM4SF4 (Transmembrane 4 L six Family Member 4; FLJ31015; ILTMP; il-TMP) (APC); Transmembrane 4 L six Family Member 4; il-TMP; anti-TM4SF4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4000000
Specificity
Recognizes TM4SF4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TM4SF4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TM4SF4 (NP_004608.1, 1aa-202aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TM4SF4 expression in transfected 293T cell line by TM4SF4 monoclonal antibody (M03), clone 4E6.Lane 1: TM4SF4 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TM4SF4 expression in transfected 293T cell line by TM4SF4 monoclonal antibody (M03), clone 4E6.Lane 1: TM4SF4 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-TM4SF4 antibody
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-TM4SF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,396 Da
NCBI Official Full Name
transmembrane 4 L6 family member 4
NCBI Official Synonym Full Names
transmembrane 4 L six family member 4
NCBI Official Symbol
TM4SF4
NCBI Official Synonym Symbols
ILTMP; il-TMP
NCBI Protein Information
transmembrane 4 L6 family member 4; transmembrane 4 superfamily member 4; intestine and liver tetraspan membrane protein; intestinal and liver (il) tetraspan membrane protein
UniProt Protein Name
Transmembrane 4 L6 family member 4
Protein Family
UniProt Gene Name
TM4SF4
UniProt Synonym Gene Names
ILTMP; IL-TMP
UniProt Entry Name
T4S4_HUMAN

Similar Products

Product Notes

The TM4SF4 tm4sf4 (Catalog #AAA6169722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TM4SF4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TM4SF4 tm4sf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TM4SF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.