Mouse anti-Human Thioredoxin Domain-containing Protein 4 Monoclonal Antibody | anti-TXNDC4 antibody

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (Biotin)

Cat. Num. AAA6145000

• Gene Names: ERP44; PDIA10; TXNDC4
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Thioredoxin Domain-containing Protein 4; Monoclonal Antibody; Thioredoxin Domain-containing Protein 4 (TXNDC4; Endoplasmic Reticulum Resident Protein 44; ER Protein 44; ERp44; KIAA0573; PDIA10; UNQ532/PRO1075) (Biotin); anti-TXNDC4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3C7
• Specificity: Recognizes human TXNDC4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TXNDC4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa30-407 from TXNDC4 (AAH05374) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (67.58kD).)

Western Blot (WB)

(Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 monoclonal antibody Lane 1: TXNDC4 transfected lysate (47kD). Lane 2: Non-transfected lysate. )

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of TXNDC4 transfected lysate using TXNDC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXNDC4 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TXNDC4 is 1ng/ml as a capture antibody.)

Western Blot (WB)

(TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in A-431)

Western Blot (WB)

(TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in K-562.)

Product Categories/Family for anti-TXNDC4 antibody

Antibodies; Thioredoxin

NCBI and Uniprot Product Information

• NCBI GI #: 13529223
• NCBI GeneID: 23071
• Molecular Weight: 47KD
• NCBI Official Full Name: Homo sapiens endoplasmic reticulum protein 44, mRNA
• NCBI Official Synonym Full Names: endoplasmic reticulum protein 44
• NCBI Official Symbol: ERP44
• NCBI Official Synonym Symbols: PDIA10; TXNDC4
• NCBI Protein Information: endoplasmic reticulum resident protein 44

NCBI Description

This gene encodes a member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. It has an inferred N-terminal signal peptide, a catalytically active thioredoxin (TRX) domain, two TRX-like domains and a C-terminal ER-retention sequence. This protein functions as a pH-regulated chaperone of the secretory pathway and likely plays a role in protein quality control at the endoplasmic reticulum - Golgi interface. [provided by RefSeq, Dec 2016]