Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged THAP11 is 1ng/ml as a capture antibody.)

Mouse anti-Human THAP11 Monoclonal Antibody | anti-THAP11 antibody

THAP11 (THAP Domain-containing Protein 11, HRIHFB2206) (PE)

Gene Names
THAP11; RONIN; CTG-B43a; CTG-B45d; HRIHFB2206
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
THAP11; Monoclonal Antibody; THAP11 (THAP Domain-containing Protein 11; HRIHFB2206) (PE); CTG-B43a; CTG-B45d; RONIN; anti-THAP11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C11
Specificity
Recognizes human THAP11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-THAP11 antibody
ELISA (EIA)
Application Notes
ELISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-86 from human THAP11 (NP_065190) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged THAP11 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged THAP11 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-THAP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,455 Da
NCBI Official Full Name
THAP domain-containing protein 11
NCBI Official Synonym Full Names
THAP domain containing 11
NCBI Official Symbol
THAP11
NCBI Official Synonym Symbols
RONIN; CTG-B43a; CTG-B45d; HRIHFB2206
NCBI Protein Information
THAP domain-containing protein 11
UniProt Protein Name
THAP domain-containing protein 11
UniProt Gene Name
THAP11
UniProt Entry Name
THA11_HUMAN

Uniprot Description

THAP11: Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers. Belongs to the THAP11 family. Interacts (via coiled coil domain) with HCFC1.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nucleoplasm; intercellular bridge; cytoplasm

Molecular Function: protein binding; DNA binding; zinc ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The THAP11 thap11 (Catalog #AAA6160705) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The THAP11 (THAP Domain-containing Protein 11, HRIHFB2206) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THAP11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). ELISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the THAP11 thap11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "THAP11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.