Mouse anti-Human TGFB1I1 Monoclonal Antibody | anti-Tgfb1i1 antibody

TGFB1I1 (ARA55, Transforming Growth Factor beta-1-induced Transcript 1 Protein, Androgen Receptor Coactivator 55kD Protein, Androgen Receptor-associated Protein of 55kD, Hydrogen Peroxide-inducible Clone 5 Protein)

Cat. Num. AAA6002426

• Gene Names: Tgfb1i1; Hic5; ARA55; TSC-5; hic-5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TGFB1I1; Monoclonal Antibody; TGFB1I1 (ARA55; Transforming Growth Factor beta-1-induced Transcript 1 Protein; Androgen Receptor Coactivator 55kD Protein; Androgen Receptor-associated Protein of 55kD; Hydrogen Peroxide-inducible Clone 5 Protein); Anti -TGFB1I1 (ARA55; anti-Tgfb1i1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B2-D8
• Specificity: Recognizes human TGFB1I1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGA

• Applicable Applications for anti-Tgfb1i1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-445 from human TGFB1I1 (AAH32545) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TGFB1I1 monoclonal antibody, Western Blot analysis of TGFB1I1 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of TGFB1I1 expression in transfected 293T cell line by TGFB1I1 monoclonal antibody.|Lane 1: TGFB1I1 transfected lysate (47.9kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TGFB1I1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TGFB1I1 over-expressed 293 cell line, cotransfected with TGFB1I1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TGFB1I1 monoclonal antibody, GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-Tgfb1i1 antibody

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-Tgfb1i1 antibody

Antibodies; Abs to Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 6678313
• NCBI GeneID: 21804
• NCBI Accession #: NP_033391.1
• NCBI GenBank Nucleotide #: NM_009365.2
• UniProt Accession #: Q62219; Q3YBY7; Q3YBY8; Q3YBZ0; Q3YBZ1; Q3YBZ3; Q3YBZ4; Q3YBZ5; Q3YBZ6
• Molecular Weight: 50,101 Da
• NCBI Official Full Name: transforming growth factor beta-1-induced transcript 1 protein
• NCBI Official Synonym Full Names: transforming growth factor beta 1 induced transcript 1
• NCBI Official Symbol: Tgfb1i1
• NCBI Official Synonym Symbols: Hic5; ARA55; TSC-5; hic-5
• NCBI Protein Information: transforming growth factor beta-1-induced transcript 1 protein; TGF beta-stimulated clone 5; hydrogen peroxide-inducible clone 5 protein; androgen receptor-associated protein of 55 kDa
• UniProt Protein Name: Transforming growth factor beta-1-induced transcript 1 protein
• Protein Family: Transforming growth factor beta-1-induced transcript 1 protein
• UniProt Gene Name: Tgfb1i1
• UniProt Synonym Gene Names: Ara55; Hic-5; TSC-5
• UniProt Entry Name: TGFI1_MOUSE

Uniprot Description

Hic-5: Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA- binding activity. Homooligomer. Interacts with CRIP2, HSPB1, ILK, LIMS1, LIMS2, NCK2, NUDT16L1, PAK, PPARG, PTPN12, TCF3, TCF7L2 and VCL. Forms a complex with GIT1 and ARHGEF7. Interacts with AR/androgen receptor in a ligand-dependent manner. Interacts with CSK, LYN, MAPK15, NR3C1, PPARG, PTK2/FAK1, PTK2B/PYK2, SLC6A3, SLC6A4, SMAD3, SRC and talin. Up-regulated by TNF and hydrogen peroxide. Expressed in platelets, smooth muscle and prostate stromal cells. Belongs to the paxillin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Cellular Component: extracellular matrix; focal adhesion; cytoskeleton; cytoplasm; intracellular; cell junction; nucleus

Molecular Function: protein binding; Roundabout binding; androgen receptor binding; zinc ion binding; metal ion binding; transcription coactivator activity

Biological Process: morphogenesis of embryonic epithelium; Wnt receptor signaling pathway; cell fate commitment; epithelial cell differentiation; response to heat; positive regulation of transcription, DNA-dependent; positive regulation of transforming growth factor beta receptor signaling pathway; negative regulation of transforming growth factor beta receptor signaling pathway; ubiquitin-dependent SMAD protein catabolic process; cell differentiation; negative regulation of fat cell differentiation