Mouse anti-Human TGFB1I1 Monoclonal Antibody | anti-TGFB1I1 antibody

TGFB1I1 (ARA55, Transforming Growth Factor beta-1-induced Transcript 1 Protein, Androgen Receptor Coactivator 55kD Protein, Androgen Receptor-associated Protein of 55kD, Hydrogen Peroxide-inducible Clone 5 Protein) (FITC)

Cat. Num. AAA6150093

• Gene Names: TGFB1I1; HIC5; ARA55; HIC-5; TSC-5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TGFB1I1; Monoclonal Antibody; TGFB1I1 (ARA55; Transforming Growth Factor beta-1-induced Transcript 1 Protein; Androgen Receptor Coactivator 55kD Protein; Androgen Receptor-associated Protein of 55kD; Hydrogen Peroxide-inducible Clone 5 Protein) (FITC); anti-TGFB1I1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B2-D8
• Specificity: Recognizes human TGFB1I1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1790

• Applicable Applications for anti-TGFB1I1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-445 from human TGFB1I1 (AAH32545) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TGFB1I1 monoclonal antibody, Western Blot analysis of TGFB1I1 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of TGFB1I1 expression in transfected 293T cell line by TGFB1I1 monoclonal antibody. Lane 1: TGFB1I1 transfected lysate (47.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TGFB1I1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TGFB1I1 over-expressed 293 cell line, cotransfected with TGFB1I1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TGFB1I1 monoclonal antibody, GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-TGFB1I1 antibody

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-TGFB1I1 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 21619704
• NCBI GeneID: 7041
• NCBI Official Full Name: Homo sapiens transforming growth factor beta 1 induced transcript 1, mRNA
• NCBI Official Synonym Full Names: transforming growth factor beta 1 induced transcript 1
• NCBI Official Symbol: TGFB1I1
• NCBI Official Synonym Symbols: HIC5; ARA55; HIC-5; TSC-5
• NCBI Protein Information: transforming growth factor beta-1-induced transcript 1 protein
• Protein Family: Transforming growth factor beta-1-induced transcript 1 protein

NCBI Description

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]