Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FEN1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FEN1 Polyclonal Antibody | anti-FEN1 antibody

FEN1 Antibody - C-terminal region

Gene Names
FEN1; MF1; RAD2; FEN-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FEN1; Polyclonal Antibody; FEN1 Antibody - C-terminal region; anti-FEN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK
Sequence Length
316
Applicable Applications for anti-FEN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FEN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FEN1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FEN1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FEN1 antibody
The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
flap endonuclease 1
NCBI Official Synonym Full Names
flap structure-specific endonuclease 1
NCBI Official Symbol
FEN1
NCBI Official Synonym Symbols
MF1; RAD2; FEN-1
NCBI Protein Information
flap endonuclease 1
UniProt Protein Name
Flap endonuclease 1
UniProt Gene Name
FEN1
UniProt Synonym Gene Names
RAD2; FEN-1; MF1; hFEN-1
UniProt Entry Name
FEN1_HUMAN

NCBI Description

The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions. [provided by RefSeq, Jul 2008]

Uniprot Description

FEN1: Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double- stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA. Interacts with PCNA. Three molecules of FEN1 bind to one PCNA trimer with each molecule binding to one PCNA monomer. PCNA stimulates the nuclease activity without altering cleavage specificity. The C-terminal domain binds EP300. Can bind simultaneously to both PCNA and EP300. Interacts with DDX11. Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.

Protein type: Ribonuclease; DNA repair, damage; Nucleolus; EC 3.1.-.-; Nuclear receptor co-regulator; DNA-binding; Deoxyribonuclease

Chromosomal Location of Human Ortholog: 11q12

Cellular Component: nucleoplasm; membrane; mitochondrion; plasma membrane; nucleolus; nucleus

Molecular Function: 5'-3' exonuclease activity; protein binding; DNA binding; 5'-flap endonuclease activity; manganese ion binding; endonuclease activity; exonuclease activity; double-stranded DNA binding; damaged DNA binding; magnesium ion binding; ribonuclease H activity; double-stranded DNA specific exodeoxyribonuclease activity

Biological Process: telomere maintenance via semi-conservative replication; DNA replication, removal of RNA primer; UV protection; base-excision repair; double-strand break repair; telomere maintenance via recombination; mitotic cell cycle; DNA strand elongation during DNA replication; DNA replication; DNA catabolic process, exonucleolytic; DNA repair; telomere maintenance; DNA catabolic process, endonucleolytic; memory

Research Articles on FEN1

Similar Products

Product Notes

The FEN1 fen1 (Catalog #AAA3223215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FEN1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FEN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FEN1 fen1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRQGSTQGRL DDFFKVTGSL SSAKRKEPEP KGSTKKKAKT GAAGKFKRGK. It is sometimes possible for the material contained within the vial of "FEN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.