Mouse anti-Human TG Monoclonal Antibody | anti-TG antibody

TG (Thyroglobulin) (FITC)

Cat. Num. AAA6150092

• Gene Names: TG; TGN; AITD3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TG; Monoclonal Antibody; TG (Thyroglobulin) (FITC); anti-TG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G3
• Specificity: Recognizes human TG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 2768

• Applicable Applications for anti-TG antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2659-2769 from human TG (NP_003226) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TG on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TG is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TG antibody

Antibodies; Hormones; Steroids

NCBI and Uniprot Product Information

• NCBI GI #: 55770862
• NCBI GeneID: 7038
• NCBI Accession #: NP_003226
• NCBI GenBank Nucleotide #: NM_003235
• UniProt Accession #: P01266
• NCBI Official Full Name: thyroglobulin
• NCBI Official Synonym Full Names: thyroglobulin
• NCBI Official Symbol: TG
• NCBI Official Synonym Symbols: TGN; AITD3
• NCBI Protein Information: thyroglobulin
• UniProt Protein Name: Thyroglobulin
• Protein Family: TGB2 protein
• UniProt Gene Name: TG
• UniProt Synonym Gene Names: Tg
• UniProt Entry Name: THYG_HUMAN

NCBI Description

Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. [provided by RefSeq, Nov 2009]

Uniprot Description

TG: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). Defects in TG are the cause of thyroid dyshormonogenesis 3 (TDH3). A disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases. Variations in TG are associated with susceptibility to autoimmune thyroid disease type 3 (AITD3). AITDs including Graves disease (GD) and Hashimoto thyroiditis (HT), are among the most common human autoimmune diseases. They are complex diseases, which are caused by an interaction between susceptibility genes and nongenetic factors, such as infection. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: extracellular space; extracellular region

Molecular Function: hormone activity

Biological Process: regulation of myelination; iodide transport; thyroid gland development; hormone biosynthetic process; signal transduction; thyroid hormone metabolic process

Disease: Thyroid Dyshormonogenesis 3; Autoimmune Thyroid Disease, Susceptibility To, 3