Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TG on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human TG Monoclonal Antibody | anti-TG antibody

TG (Thyroglobulin) (Biotin)

Gene Names
TG; TGN; AITD3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TG; Monoclonal Antibody; TG (Thyroglobulin) (Biotin); anti-TG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G3
Specificity
Recognizes human TG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2768
Applicable Applications for anti-TG antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2659-2769 from human TG (NP_003226) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TG on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TG on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TG is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TG is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
thyroglobulin
NCBI Official Synonym Full Names
thyroglobulin
NCBI Official Symbol
TG
NCBI Official Synonym Symbols
TGN; AITD3
NCBI Protein Information
thyroglobulin
UniProt Protein Name
Thyroglobulin
Protein Family
UniProt Gene Name
TG
UniProt Synonym Gene Names
Tg
UniProt Entry Name
THYG_HUMAN

NCBI Description

Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. [provided by RefSeq, Nov 2009]

Uniprot Description

TG: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). Defects in TG are the cause of thyroid dyshormonogenesis 3 (TDH3). A disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases. Variations in TG are associated with susceptibility to autoimmune thyroid disease type 3 (AITD3). AITDs including Graves disease (GD) and Hashimoto thyroiditis (HT), are among the most common human autoimmune diseases. They are complex diseases, which are caused by an interaction between susceptibility genes and nongenetic factors, such as infection. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: extracellular space; extracellular region

Molecular Function: hormone activity

Biological Process: regulation of myelination; iodide transport; thyroid gland development; hormone biosynthetic process; signal transduction; thyroid hormone metabolic process

Disease: Thyroid Dyshormonogenesis 3; Autoimmune Thyroid Disease, Susceptibility To, 3

Research Articles on TG

Similar Products

Product Notes

The TG tg (Catalog #AAA6144789) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TG (Thyroglobulin) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TG tg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.