Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TFDP3 Monoclonal Antibody | anti-TFDP3 antibody

TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (FITC)

Gene Names
TFDP3; DP4; CT30; HCA661
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TFDP3; Monoclonal Antibody; TFDP3 (Transcription Factor Dp Family Member 3; Cancer/testis Antigen 30; CT30; DP4; Hepatocellular Carcinoma-associated Antigen 661; HCA661) (FITC); anti-TFDP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes human TFDP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TFDP3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human TFDP3 (NP_057605) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(TFDP3 monoclonal antibody, Western Blot analysis of TFDP3 expression in IMR-32.)

Western Blot (WB) (TFDP3 monoclonal antibody, Western Blot analysis of TFDP3 expression in IMR-32.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TFDP3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TFDP3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TFDP3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TFDP3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TFDP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
transcription factor Dp family member 3
NCBI Official Synonym Full Names
transcription factor Dp family member 3
NCBI Official Symbol
TFDP3
NCBI Official Synonym Symbols
DP4; CT30; HCA661
NCBI Protein Information
transcription factor Dp family member 3
UniProt Protein Name
Transcription factor Dp family member 3
Protein Family
UniProt Gene Name
TFDP3
UniProt Synonym Gene Names
DP4; HCA661
UniProt Entry Name
TFDP3_HUMAN

NCBI Description

This gene encodes a member of the DP family of transcription factors. These factors heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. This protein functions as a negative regulator and inhibits the DNA binding and transcriptional activities of E2F factors.[provided by RefSeq, May 2010]

Research Articles on TFDP3

Similar Products

Product Notes

The TFDP3 tfdp3 (Catalog #AAA6150088) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TFDP3 (Transcription Factor Dp Family Member 3, Cancer/testis Antigen 30, CT30, DP4, Hepatocellular Carcinoma-associated Antigen 661, HCA661) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFDP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFDP3 tfdp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFDP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.