Western Blot (WB)
(TFDP3 monoclonal antibody (M02), clone 3F11 Western Blot analysis of TFDP3 expression in IMR-32.)
Mouse TFDP3 Monoclonal Antibody | anti-TFDP3 antibody
TFDP3 (Transcription Factor Dp Family, Member 3, CT30, E2F-like, HCA661, MGC161639) (APC)
Gene Names
TFDP3; DP4; CT30; HCA661
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TFDP3; Monoclonal Antibody; TFDP3 (Transcription Factor Dp Family; Member 3; CT30; E2F-like; HCA661; MGC161639) (APC); Transcription Factor Dp Family; MGC161639; anti-TFDP3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F11
Specificity
Recognizes TFDP3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TFDP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TFDP3 (NP_057605, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(TFDP3 monoclonal antibody (M02), clone 3F11 Western Blot analysis of TFDP3 expression in IMR-32.)
Western Blot (WB)
(TFDP3 monoclonal antibody (M02), clone 3F11 Western Blot analysis of TFDP3 expression in IMR-32.)
Western Blot (WB)
(TFDP3 monoclonal antibody (M02), clone 3F11. Western Blot analysis of TFDP3 expression in NIH/3T3.)
Western Blot (WB)
(TFDP3 monoclonal antibody (M02), clone 3F11. Western Blot analysis of TFDP3 expression in NIH/3T3.)
Related Product Information for anti-TFDP3 antibody
TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]). [supplied by OMIM]
Product Categories/Family for anti-TFDP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
transcription factor Dp family member 3
NCBI Official Synonym Full Names
transcription factor Dp family member 3
NCBI Official Symbol
TFDP3
NCBI Official Synonym Symbols
DP4; CT30; HCA661
NCBI Protein Information
transcription factor Dp family member 3
UniProt Protein Name
Transcription factor Dp family member 3
Protein Family
UniProt Gene Name
TFDP3
UniProt Synonym Gene Names
DP4; HCA661
UniProt Entry Name
TFDP3_HUMAN
NCBI Description
This gene encodes a member of the DP family of transcription factors. These factors heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. This protein functions as a negative regulator and inhibits the DNA binding and transcriptional activities of E2F factors.[provided by RefSeq, May 2010]
Research Articles on TFDP3
Similar Products
Product Notes
The TFDP3 tfdp3 (Catalog #AAA6168010) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TFDP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFDP3 tfdp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFDP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
