Mouse anti-Human TECTA Monoclonal Antibody | anti-TECTA antibody

TECTA (Alpha-tectorin, DFNA12, DFNA8, DFNB21) (MaxLight 550)

Cat. Num. AAA6214375

• Gene Names: TECTA; DFNA8; DFNA12; DFNB21
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TECTA; Monoclonal Antibody; TECTA (Alpha-tectorin; DFNA12; DFNA8; DFNB21) (MaxLight 550); anti-TECTA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A5
• Specificity: Recognizes human TECTA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
• Sequence Length: 2155

• Applicable Applications for anti-TECTA antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1981-2081 from human TECTA (NP_005413) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPI
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-TECTA antibody

One of the major non-collagenous components of the tectorial membrane. The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Product Categories/Family for anti-TECTA antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 134268640
• NCBI GeneID: 7007
• NCBI Accession #: NP_005413
• NCBI GenBank Nucleotide #: NM_005422
• UniProt Accession #: O75443
• NCBI Official Full Name: alpha-tectorin
• NCBI Official Synonym Full Names: tectorin alpha
• NCBI Official Symbol: TECTA
• NCBI Official Synonym Symbols: DFNA8; DFNA12; DFNB21
• NCBI Protein Information: alpha-tectorin
• UniProt Protein Name: Alpha-tectorin
• Protein Family: Alpha-tectorin
• UniProt Gene Name: TECTA

NCBI Description

The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness. [provided by RefSeq, Jul 2008]

Uniprot Description

TECTA: One of the major non-collagenous components of the tectorial membrane. The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Defects in TECTA are the cause of deafness autosomal dominant type 12 (DFNA12); also known as DFNA8. DFNA12 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Defects in TECTA are the cause of deafness autosomal recessive type 21 (DFNB21).

Protein type: Extracellular matrix; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11q23.3

Disease: Deafness, Autosomal Dominant 12; Deafness, Autosomal Recessive 21