Beta-tectorin (Tectb) Recombinant Protein | Tectb recombinant protein

Recombinant Mouse Beta-tectorin (Tectb)

Cat. Num. AAA7053536

• Gene Names: Tectb; Tctnb
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Beta-tectorin (Tectb); Recombinant Mouse Beta-tectorin (Tectb); Tectb recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 18-305. Full Length of Mature Protein
• Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA
• Sequence Length: 305

• Species: Mus musculus (Mouse)
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

SDS-PAGE

Related Product Information for Tectb recombinant protein

One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Product Categories/Family for Tectb recombinant protein

Transmembrane Protein

References

"The mouse tectorins. Modular matrix proteins of the inner ear homologous to components of the sperm-egg adhesion system."Legan P.K., Rau A., Keene J.N., Richardson G.P.J. Biol. Chem. 272:8791-8801(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 7363457
• NCBI GeneID: 21684
• NCBI Accession #: NP_033374.2
• NCBI GenBank Nucleotide #: NM_009348.3
• UniProt Accession #: O08524
• Molecular Weight: 36.5 kDa
• NCBI Official Full Name: beta-tectorin
• NCBI Official Synonym Full Names: tectorin beta
• NCBI Official Symbol: Tectb
• NCBI Official Synonym Symbols: Tctnb
• NCBI Protein Information: beta-tectorin
• UniProt Protein Name: Beta-tectorin
• Protein Family: Beta-tectorin
• UniProt Gene Name: Tectb

Uniprot Description

One of the major non-collagenous components of the tectorial membrane (). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.