Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.05kD).)

Mouse anti-Human TCL1A Monoclonal Antibody | anti-TCL1A antibody

TCL1A (T-cell Leukemia/lymphoma Protein 1A, TCL1, Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1) (HRP)

Gene Names
TCL1A; TCL1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCL1A; Monoclonal Antibody; TCL1A (T-cell Leukemia/lymphoma Protein 1A; TCL1; Oncogene TCL1; Oncogene TCL-1; Protein p14 TCL1) (HRP); anti-TCL1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G10
Specificity
Recognizes human TCL1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TCL1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa61-115 from TCL1A (NP_068801) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.05kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.05kD).)

Western Blot (WB)

(Western Blot analysis of TCL1A expression in transfected 293T cell line by TCL1A monoclonal antibody Lane 1: TCL1A transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TCL1A expression in transfected 293T cell line by TCL1A monoclonal antibody Lane 1: TCL1A transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TCL1A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TCL1A is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-TCL1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,460 Da
NCBI Official Full Name
T-cell leukemia/lymphoma protein 1A
NCBI Official Synonym Full Names
T-cell leukemia/lymphoma 1A
NCBI Official Symbol
TCL1A
NCBI Official Synonym Symbols
TCL1
NCBI Protein Information
T-cell leukemia/lymphoma protein 1A

NCBI Description

Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]

Research Articles on TCL1A

Similar Products

Product Notes

The TCL1A (Catalog #AAA6155363) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TCL1A (T-cell Leukemia/lymphoma Protein 1A, TCL1, Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCL1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCL1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCL1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.