Mouse anti-Human TCL1A Monoclonal Antibody | anti-TCL1A antibody

TCL1A (T-cell Leukemia/lymphoma Protein 1A, TCL1, Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1) (Biotin)

Cat. Num. AAA6144757

• Gene Names: TCL1A; TCL1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TCL1A; Monoclonal Antibody; TCL1A (T-cell Leukemia/lymphoma Protein 1A; TCL1; Oncogene TCL1; Oncogene TCL-1; Protein p14 TCL1) (Biotin); anti-TCL1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G10
• Specificity: Recognizes human TCL1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TCL1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa61-115 from TCL1A (NP_068801) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.05kD).)

Western Blot (WB)

(Western Blot analysis of TCL1A expression in transfected 293T cell line by TCL1A monoclonal antibody Lane 1: TCL1A transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TCL1A is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-TCL1A antibody

Antibodies; Cancer Markers; Leukemia

NCBI and Uniprot Product Information

• NCBI GI #: 11415028
• NCBI GeneID: 8115
• NCBI Accession #: NP_068801.1
• NCBI GenBank Nucleotide #: NM_021966
• Molecular Weight: 13,460 Da
• NCBI Official Full Name: T-cell leukemia/lymphoma protein 1A
• NCBI Official Synonym Full Names: T-cell leukemia/lymphoma 1A
• NCBI Official Symbol: TCL1A
• NCBI Official Synonym Symbols: TCL1
• NCBI Protein Information: T-cell leukemia/lymphoma protein 1A
• Protein Family: T-cell leukemia/lymphoma protein

NCBI Description

Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]