Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TCF12 monoclonal antibody, Western Blot analysis of TCF12 expression in Jurkat.)

Mouse anti-Human TCF12 Monoclonal Antibody | anti-TCF12 antibody

TCF12 (Transcription Factor 12, DNA Binding Protein HTF4, E-box-binding Protein, HEB, HTF4, Transcription Factor HTF4) (PE)

Gene Names
TCF12; HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCF12; Monoclonal Antibody; TCF12 (Transcription Factor 12; DNA Binding Protein HTF4; E-box-binding Protein; HEB; HTF4; Transcription Factor HTF4) (PE); anti-TCF12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Specificity
Recognizes human TCF12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TCF12 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa364-454 from human TCF12 (NP_996919) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TCF12 monoclonal antibody, Western Blot analysis of TCF12 expression in Jurkat.)

Western Blot (WB) (TCF12 monoclonal antibody, Western Blot analysis of TCF12 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody. Lane 1: TCF12 transfected lysate (75.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody. Lane 1: TCF12 transfected lysate (75.8kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Western Blot (WB)

(Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TCF12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
transcription factor 12 isoform a
NCBI Official Synonym Full Names
transcription factor 12
NCBI Official Symbol
TCF12
NCBI Official Synonym Symbols
HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
NCBI Protein Information
transcription factor 12
UniProt Protein Name
Transcription factor 12
Protein Family
UniProt Gene Name
TCF12
UniProt Synonym Gene Names
BHLHB20; HEB; HTF4; TCF-12; bHLHb20
UniProt Entry Name
HTF4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TCF12 iso3: Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems. Efficient DNA binding requires dimerization with another bHLH protein. Forms homo- or hetero-oligomers with myogenin, E12 and ITF2 proteins. Interacts with PTF1A.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity; bHLH transcription factor binding; SMAD binding; transcription factor binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; muscle development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of neuron differentiation

Research Articles on TCF12

Similar Products

Product Notes

The TCF12 tcf12 (Catalog #AAA6160657) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TCF12 (Transcription Factor 12, DNA Binding Protein HTF4, E-box-binding Protein, HEB, HTF4, Transcription Factor HTF4) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCF12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCF12 tcf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCF12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.