Mouse anti-Human TCF12 Monoclonal Antibody | anti-TCF12 antibody

TCF12 (Transcription Factor 12, DNA Binding Protein HTF4, E-box-binding Protein, HEB, HTF4, Transcription Factor HTF4) (HRP)

Cat. Num. AAA6155354

• Gene Names: TCF12; HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TCF12; Monoclonal Antibody; TCF12 (Transcription Factor 12; DNA Binding Protein HTF4; E-box-binding Protein; HEB; HTF4; Transcription Factor HTF4) (HRP); anti-TCF12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E9
• Specificity: Recognizes human TCF12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TCF12 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa364-454 from human TCF12 (NP_996919) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TCF12 monoclonal antibody, Western Blot analysis of TCF12 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody. Lane 1: TCF12 transfected lysate (75.8kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Western Blot (WB)

(Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-TCF12 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 46370080
• NCBI GeneID: 6938
• NCBI Accession #: NP_996919
• NCBI GenBank Nucleotide #: NM_207036
• UniProt Accession #: Q99081
• Molecular Weight: 73kDa
• NCBI Official Full Name: transcription factor 12 isoform a
• NCBI Official Synonym Full Names: transcription factor 12
• NCBI Official Symbol: TCF12
• NCBI Official Synonym Symbols: HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
• NCBI Protein Information: transcription factor 12
• UniProt Protein Name: Transcription factor 12
• Protein Family: Transcription factor
• UniProt Gene Name: TCF12
• UniProt Synonym Gene Names: BHLHB20; HEB; HTF4; TCF-12; bHLHb20
• UniProt Entry Name: HTF4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TCF12 iso3: Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems. Efficient DNA binding requires dimerization with another bHLH protein. Forms homo- or hetero-oligomers with myogenin, E12 and ITF2 proteins. Interacts with PTF1A.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity; bHLH transcription factor binding; SMAD binding; transcription factor binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; muscle development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of neuron differentiation