Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TAX1BP3 Monoclonal Antibody | anti-TAX1BP3 antibody

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (MaxLight 550)

Gene Names
TAX1BP3; TIP1; TIP-1
Applications
Western Blot
Purity
Purified
Synonyms
TAX1BP3; Monoclonal Antibody; TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3; TIP-1) (MaxLight 550); Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3; TIP-1; anti-TAX1BP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H5
Specificity
Recognizes TAX1BP3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
124
Applicable Applications for anti-TAX1BP3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TAX1BP3 (AAH23980, 1aa-124aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TAX1BP3 antibody
Mouse monoclonal antibody raised against a full-length recombinant TAX1BP3.
Product Categories/Family for anti-TAX1BP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tax1 (human T-cell leukemia virus type I) binding protein 3
NCBI Official Synonym Full Names
Tax1 binding protein 3
NCBI Official Symbol
TAX1BP3
NCBI Official Synonym Symbols
TIP1; TIP-1
NCBI Protein Information
tax1-binding protein 3
Protein Family

NCBI Description

This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017]

Research Articles on TAX1BP3

Similar Products

Product Notes

The TAX1BP3 (Catalog #AAA6219542) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TAX1BP3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAX1BP3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAX1BP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.