Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CDC42BPB monoclonal antibody Western Blot analysis of CDC42BPB expression in PC-12)

Mouse anti-Human, Rat CDC42BPB Monoclonal Antibody | anti-CDC42BPB antibody

CDC42BPB (Serine/Threonine-protein Kinase MRCK beta, CDC42-binding Protein Kinase beta, CDC42BP-beta, DMPK-like beta, Myotonic Dystrophy Kinase-related CDC42-binding Kinase beta, MRCK beta, Myotonic Dystrophy Protein Kinase-like beta, KIAA1124) (Biotin)

Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC42BPB; Monoclonal Antibody; CDC42BPB (Serine/Threonine-protein Kinase MRCK beta; CDC42-binding Protein Kinase beta; CDC42BP-beta; DMPK-like beta; Myotonic Dystrophy Kinase-related CDC42-binding Kinase beta; MRCK beta; Myotonic Dystrophy Protein Kinase-like beta; KIAA1124) (Biotin); anti-CDC42BPB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F4
Specificity
Recognizes human CDC42BPB. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
6780
Applicable Applications for anti-CDC42BPB antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1580-1679 from CDC42BPB (AAD37506) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CDC42BPB monoclonal antibody Western Blot analysis of CDC42BPB expression in PC-12)

Western Blot (WB) (CDC42BPB monoclonal antibody Western Blot analysis of CDC42BPB expression in PC-12)

Western Blot (WB)

(CDC42BPB monoclonal antibody Western Blot analysis of CDC42BPB expression in A-431)

Western Blot (WB) (CDC42BPB monoclonal antibody Western Blot analysis of CDC42BPB expression in A-431)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDC42BPB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CDC42BPB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDC42BPB on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CDC42BPB on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CDC42BPB is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDC42BPB is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CDC42BPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Homo sapiens CDC42-binding protein kinase beta (CDC42BPB) mRNA, complete cds

Similar Products

Product Notes

The CDC42BPB (Catalog #AAA6141105) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC42BPB (Serine/Threonine-protein Kinase MRCK beta, CDC42-binding Protein Kinase beta, CDC42BP-beta, DMPK-like beta, Myotonic Dystrophy Kinase-related CDC42-binding Kinase beta, MRCK beta, Myotonic Dystrophy Protein Kinase-like beta, KIAA1124) (Biotin) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42BPB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC42BPB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC42BPB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.