Mouse TAF7 Monoclonal Antibody | anti-TAF7 antibody

TAF7 (TAF7 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 55kD, TAF2F, TAFII55) (FITC)

Cat. Num. AAA6176179

• Gene Names: TAF7; TAF2F; TAFII55
• Applications: Western Blot
• Purity: Purified
• Synonyms: TAF7; Monoclonal Antibody; TAF7 (TAF7 RNA Polymerase II; TATA Box Binding Protein (TBP)-Associated Factor; 55kD; TAF2F; TAFII55) (FITC); TAF7 RNA Polymerase II; TAFII55; anti-TAF7 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G6
• Specificity: Recognizes TAF7.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 349

• Applicable Applications for anti-TAF7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TAF7 (AAH32737, 130aa-224aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TAF7 monoclonal antibody (M02), clone 3G6 Western Blot analysis of TAF7 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged TAF7 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-TAF7 antibody

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq]

Product Categories/Family for anti-TAF7 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 22749798
• NCBI GeneID: 6879
• NCBI Official Full Name: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 7
• NCBI Official Symbol: TAF7
• NCBI Official Synonym Symbols: TAF2F; TAFII55
• NCBI Protein Information: transcription initiation factor TFIID subunit 7
• Protein Family: Transcription initiation factor

NCBI Description

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]