Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human TAF1L Monoclonal Antibody | anti-TAF1L antibody

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910)

Gene Names
TAF1L; TAF2A2
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TAF1L; Monoclonal Antibody; TAF1L (Transcription Initiation Factor TFIID Subunit 1-like; Transcription Initiation Factor TFIID 210kD Subunit; TAF(II)210; TBP-associated Factor 210kD; TBP-associated Factor 1-like; MGC134910); Anti -TAF1L (Transcription Initiation Factor TFIID Subunit 1-like; anti-TAF1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E12
Specificity
Recognizes human TAF1L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK
Applicable Applications for anti-TAF1L antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Immunogen
Partial recombinant protein corresponding to aa1532-1642 from human TAF1L (NP_722516) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TAF1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TAF1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TAF1L is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TAF1L is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-TAF1L antibody
May act as a functional substitute for TAF1/TAFII250 during male meiosis, when sex chromosomes are transcriptionally silenced.
Product Categories/Family for anti-TAF1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
207,302 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 1-like
NCBI Official Synonym Full Names
TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
NCBI Official Symbol
TAF1L
NCBI Official Synonym Symbols
TAF2A2
NCBI Protein Information
transcription initiation factor TFIID subunit 1-like; TAF(II)210; TBP-associated factor 1-like; TBP-associated factor 210 kDa; TBP-associated factor RNA polymerase 1-like; transcription initiation factor TFIID 210 kDa subunit
UniProt Protein Name
Transcription initiation factor TFIID subunit 1-like
UniProt Gene Name
TAF1L
UniProt Entry Name
TAF1L_HUMAN

NCBI Description

This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq, Aug 2009]

Uniprot Description

TAF1L: May act as a functional substitute for TAF1/TAFII250 during male meiosis, when sex chromosomes are transcriptionally silenced. Belongs to the TAF1 family.

Protein type: Transcription initiation complex; Kinase, protein; Protein kinase, atypical; DNA-binding; ATYPICAL group; TAF1 family

Chromosomal Location of Human Ortholog: 9p21.1

Cellular Component: nucleoplasm; transcription factor TFIID complex

Molecular Function: protein serine/threonine kinase activity; histone acetyltransferase activity; DNA binding; TATA-binding protein binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; positive regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase II promoter; gene expression; histone acetylation; male meiosis; protein amino acid phosphorylation

Research Articles on TAF1L

Similar Products

Product Notes

The TAF1L taf1l (Catalog #AAA644650) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml. Researchers should empirically determine the suitability of the TAF1L taf1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NIVTQKMMAV PDSWPFHHPV NKKFVPDYYK MIVNPVDLET IRKNISKHKY QSRESFLDDV NLILANSVKY NGPESQYTKT AQEIVNICYQ TITEYDEHLT QLEKDICTAK. It is sometimes possible for the material contained within the vial of "TAF1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.