Mouse anti-Human SUPT5H Monoclonal Antibody | anti-SUPT5H antibody

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157)

Cat. Num. AAA645884

• Gene Names: SUPT5H; SPT5; SPT5H; Tat-CT1
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SUPT5H; Monoclonal Antibody; SUPT5H (SPT5; SPT5H; Transcription Elongation Factor SPT5; DRB Sensitivity-inducing Factor 160kD Subunit; DRB Sensitivity-inducing Factor Large Subunit; Tat-cotransactivator 1 Protein; FLJ34157); Anti -SUPT5H (SPT5; anti-SUPT5H antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F1
• Specificity: Recognizes human SUPT5H.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA

• Applicable Applications for anti-SUPT5H antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa981-1088 from human SUPT5H (AAH24203) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SUPT5H monoclonal antibody Western Blot analysis of SUPT5H expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SUPT5H on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10ug/ml])

Related Product Information for anti-SUPT5H antibody

Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.

Product Categories/Family for anti-SUPT5H antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1845267
• NCBI GeneID: 6829
• UniProt Accession #: O00267; O43279; Q59G52; Q99639
• Molecular Weight: 121,000 Da
• NCBI Official Full Name: SUPT5H
• NCBI Official Synonym Full Names: suppressor of Ty 5 homolog (S. cerevisiae)
• NCBI Official Symbol: SUPT5H
• NCBI Official Synonym Symbols: SPT5; SPT5H; Tat-CT1
• NCBI Protein Information: transcription elongation factor SPT5; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit
• UniProt Protein Name: Transcription elongation factor SPT5
• UniProt Gene Name: SUPT5H
• UniProt Synonym Gene Names: SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit
• UniProt Entry Name: SPT5H_HUMAN

Uniprot Description

Function: Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences. Ref.3 Ref.4 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16 Ref.17 Ref.19 Ref.21 Ref.22 Ref.24 Ref.26 Ref.28 Ref.29

Subunit structure: Interacts with SUPT4H1 to form DSIF. DSIF interacts with the positive transcription elongation factor b complex (P-TEFb complex), which is composed of CDK9 and cyclin-T (CCNT1 or CCNT2). DSIF interacts with RNA polymerase II, and this interaction is reduced by phosphorylation of the C-terminal domain (CTD) of POLR2A by P-TEFb. DSIF also interacts with the NELF complex, which is composed of WHSC2/NELFA, COBRA1/NELFB, TH1L/NELFD and RDBP/NELFE, and this interaction occurs following prior binding of DSIF to RNA polymerase II. DSIF also interacts with PRMT1/HRMT1L2, HTATSF1/TATSF1, RNGTT/CAP1A, PRMT5/SKB1, SUPT6H, and can interact with PIN1. Component of a complex which is at least composed of HTATSF1/Tat-SF1, the P-TEFb complex components CDK9 and CCNT1, RNA polymerase II, SUPT5H, and NCL/nucleolin. Ref.3 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 Ref.18 Ref.20 Ref.21 Ref.22 Ref.23 Ref.27

Subcellular location: Nucleus Ref.11.

Tissue specificity: Ubiquitously expressed. Ref.1 Ref.11

Post-translational modification: Methylated by PRMT1/HRMT1L2 and PRMT5/SKB1. Methylation negatively regulates interaction with P-TEFb and RNA polymerase II. Ref.22Phosphorylated by CDK7 and CDK9. Phosphorylation by P-TEFb alleviates transcriptional pausing and can stimulate transcriptional elongation from the HIV-1 LTR. P-TEFb dependent phosphorylation is stimulated by the HIV-1 Tat protein. Phosphorylation may also stimulate interaction with PIN1. Bulk phosphorylation occurs predominantly in mitosis. Ref.2 Ref.14 Ref.15 Ref.16 Ref.18 Ref.19 Ref.25 Ref.31

Sequence similarities: Belongs to the SPT5 family.Contains 5 KOW domains.

Sequence caution: The sequence BAD92494.1 differs from that shown. Reason: Erroneous initiation.