Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SUPT4H1 Monoclonal Antibody | anti-SUPT4H1 antibody

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (MaxLight 550)

Gene Names
SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUPT4H1; Monoclonal Antibody; SUPT4H1 (Transcription Elongation Factor SPT4; hSPT4; DRB Sensitivity-inducing Factor 14kD Subunit; DSIF p14; DRB Sensitivity-inducing Factor Small Subunit; DSIF Small Subunit; SPT4H; SUPT4H) (MaxLight 550); anti-SUPT4H1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human SUPT4H1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SUPT4H1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa18-118 from human SUPT4H1 (NP_003159) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SUPT4H1 antibody
Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.
Product Categories/Family for anti-SUPT4H1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
transcription elongation factor SPT4
NCBI Official Synonym Full Names
SPT4 homolog, DSIF elongation factor subunit
NCBI Official Symbol
SUPT4H1
NCBI Official Synonym Symbols
SPT4; SPT4H; SUPT4H; Supt4a
NCBI Protein Information
transcription elongation factor SPT4
UniProt Protein Name
Transcription elongation factor SPT4
UniProt Gene Name
SUPT4H1
UniProt Synonym Gene Names
SPT4H; SUPT4H; hSPT4; DSIF p14; DSIF small subunit
UniProt Entry Name
SPT4H_HUMAN

NCBI Description

This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]

Research Articles on SUPT4H1

Similar Products

Product Notes

The SUPT4H1 supt4h1 (Catalog #AAA6214287) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT4H1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUPT4H1 supt4h1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUPT4H1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.