Mouse anti-Human Sulfotransferase 4A1 Monoclonal Antibody | anti-SULT4A1 antibody

Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3)

Cat. Num. AAA6002675

• Gene Names: SULT4A1; NST; BRSTL1; SULTX3; BR-STL-1; DJ388M5.3; hBR-STL-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Sulfotransferase 4A1; Monoclonal Antibody; Sulfotransferase 4A1 (ST4A1; SULT4A1; Brain Sulfotransferase-like Protein; BRSTL1; BR-STL-1; hBR-STL; hBR-STL-1; Nervous System Sulfotransferase; NST; SULTX3; DJ388M5.3); Anti -Sulfotransferase 4A1 (ST4A1; anti-SULT4A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C1
• Specificity: Recognizes human SULT4A1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*

• Applicable Applications for anti-SULT4A1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: ELISA: 1ng/ml
• Immunogen: Partial recombinant corresponding to aa1-101 from human SULT4A1 (NP_055166) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody.|Lane 1: SULT4A1 transfected lysate (33kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SULT4A1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-SULT4A1 antibody

Antibodies; Abs to Enzymes; Sulfotransferase

NCBI and Uniprot Product Information

• NCBI GI #: 7657633
• NCBI GeneID: 25830
• NCBI Accession #: NP_055166.1
• NCBI GenBank Nucleotide #: NM_014351.3
• UniProt Accession #: Q9BR01; O43728; B2R7N3
• Molecular Weight: 33,085 Da
• NCBI Official Full Name: sulfotransferase 4A1
• NCBI Official Synonym Full Names: sulfotransferase family 4A, member 1
• NCBI Official Symbol: SULT4A1
• NCBI Official Synonym Symbols: NST; BRSTL1; SULTX3; BR-STL-1; DJ388M5.3; hBR-STL-1
• NCBI Protein Information: sulfotransferase 4A1; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase
• UniProt Protein Name: Sulfotransferase 4A1
• Protein Family: Sulfotransferase
• UniProt Gene Name: SULT4A1
• UniProt Synonym Gene Names: SULTX3; ST4A1; hBR-STL; hBR-STL-1; NST
• UniProt Entry Name: ST4A1_HUMAN

NCBI Description

This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT4A1: Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.-; Transferase

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; protein binding

Biological Process: steroid metabolic process; xenobiotic metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process