Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SUFU is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human SUFU Monoclonal Antibody | anti-SUFU antibody

SUFU (Suppressor of Fused Homolog, SUFUH, SUFUXL, UNQ650/PRO1280) (Biotin)

Gene Names
SUFU; SUFUH; SUFUXL; PRO1280
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUFU; Monoclonal Antibody; SUFU (Suppressor of Fused Homolog; SUFUH; SUFUXL; UNQ650/PRO1280) (Biotin); anti-SUFU antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human SUFU.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SUFU antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aaa181-280, from human SUFU (AAH13291, 51684) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SUFU is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SUFU is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STK36 and SUFU HeLa cells were stained with STK36 rabbit purified polyclonal 1:1200 and SUFU mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between STK36 and SUFU HeLa cells were stained with STK36 rabbit purified polyclonal 1:1200 and SUFU mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-SUFU antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52,977 Da
NCBI Official Full Name
Homo sapiens suppressor of fused homolog (Drosophila), mRNA
NCBI Official Synonym Full Names
SUFU negative regulator of hedgehog signaling
NCBI Official Symbol
SUFU
NCBI Official Synonym Symbols
SUFUH; SUFUXL; PRO1280
NCBI Protein Information
suppressor of fused homolog
Protein Family

NCBI Description

The Hedgehog signaling pathway plays an important role in early human development. The pathway is a signaling cascade that plays a role in pattern formation and cellular proliferation during development. This gene encodes a negative regulator of the hedgehog signaling pathway. Defects in this gene are a cause of medulloblastoma. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Research Articles on SUFU

Similar Products

Product Notes

The SUFU (Catalog #AAA6144667) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUFU (Suppressor of Fused Homolog, SUFUH, SUFUXL, UNQ650/PRO1280) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUFU can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUFU for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUFU, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.