Mouse STYK1 Monoclonal Antibody | anti-STYK1 antibody

STYK1 (Serine/Threonine/Tyrosine Kinase 1, DKFZp761P1010, NOK, SuRTK106) (HRP)

Cat. Num. AAA6181173

• Gene Names: STYK1; NOK; SuRTK106
• Applications: Western Blot
• Purity: Purified
• Synonyms: STYK1; Monoclonal Antibody; STYK1 (Serine/Threonine/Tyrosine Kinase 1; DKFZp761P1010; NOK; SuRTK106) (HRP); Serine/Threonine/Tyrosine Kinase 1; SuRTK106; anti-STYK1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A2
• Specificity: Recognizes STYK1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STYK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: STYK1 (NP_060893, 50aa-159aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STYK1 monoclonal antibody (M04), clone 4A2 Western Blot analysis of STYK1 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged STYK1 is approximately 3ng/ml as a capture antibody.)

Product Categories/Family for anti-STYK1 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 222352145
• NCBI GeneID: 55359
• NCBI Accession #: NP_060893
• NCBI GenBank Nucleotide #: NM_018423
• UniProt Accession #: Q6J9G0; Q52LR3; Q9BXY2; Q9NSH1; B2R9T2
• Molecular Weight: 47,577 Da
• NCBI Official Full Name: tyrosine-protein kinase STYK1
• NCBI Official Synonym Full Names: serine/threonine/tyrosine kinase 1
• NCBI Official Symbol: STYK1
• NCBI Official Synonym Symbols: NOK; SuRTK106
• NCBI Protein Information: tyrosine-protein kinase STYK1; novel oncogene with kinase domain; protein PK-unique
• UniProt Protein Name: Tyrosine-protein kinase STYK1
• Protein Family: Tyrosine-protein kinase
• UniProt Gene Name: STYK1
• UniProt Synonym Gene Names: NOK
• UniProt Entry Name: STYK1_HUMAN

Uniprot Description

STYK1: Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways. Belongs to the protein kinase superfamily. Tyr protein kinase family.

Protein type: Protein kinase, TK; Oncoprotein; Kinase, protein; Membrane protein, integral; EC 2.7.10.2; Protein kinase, tyrosine (receptor); TK group; TK-Unique family

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: extrinsic to internal side of plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: innate immune response; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation