Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STYK1 monoclonal antibody (M04), clone 4A2 Western Blot analysis of STYK1 expression in HeLa.)

Mouse STYK1 Monoclonal Antibody | anti-STYK1 antibody

STYK1 (Serine/Threonine/Tyrosine Kinase 1, DKFZp761P1010, NOK, SuRTK106) (AP)

Gene Names
STYK1; NOK; SuRTK106
Applications
Western Blot
Purity
Purified
Synonyms
STYK1; Monoclonal Antibody; STYK1 (Serine/Threonine/Tyrosine Kinase 1; DKFZp761P1010; NOK; SuRTK106) (AP); Serine/Threonine/Tyrosine Kinase 1; SuRTK106; anti-STYK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4A2
Specificity
Recognizes STYK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STYK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STYK1 (NP_060893, 50aa-159aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STYK1 monoclonal antibody (M04), clone 4A2 Western Blot analysis of STYK1 expression in HeLa.)

Western Blot (WB) (STYK1 monoclonal antibody (M04), clone 4A2 Western Blot analysis of STYK1 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged STYK1 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STYK1 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-STYK1 antibody
Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]). [supplied by OMIM]
Product Categories/Family for anti-STYK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,577 Da
NCBI Official Full Name
tyrosine-protein kinase STYK1
NCBI Official Synonym Full Names
serine/threonine/tyrosine kinase 1
NCBI Official Symbol
STYK1
NCBI Official Synonym Symbols
NOK; SuRTK106
NCBI Protein Information
tyrosine-protein kinase STYK1; novel oncogene with kinase domain; protein PK-unique
UniProt Protein Name
Tyrosine-protein kinase STYK1
Protein Family
UniProt Gene Name
STYK1
UniProt Synonym Gene Names
NOK
UniProt Entry Name
STYK1_HUMAN

Uniprot Description

STYK1: Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways. Belongs to the protein kinase superfamily. Tyr protein kinase family.

Protein type: Protein kinase, TK; Oncoprotein; Kinase, protein; Membrane protein, integral; EC 2.7.10.2; Protein kinase, tyrosine (receptor); TK group; TK-Unique family

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: extrinsic to internal side of plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: innate immune response; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation

Similar Products

Product Notes

The STYK1 styk1 (Catalog #AAA6163533) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STYK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STYK1 styk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STYK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.