Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged STX16 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human STX16 Monoclonal Antibody | anti-STX16 antibody

STX16 (Syntaxin 16, Syntaxin-16, MGC90328, SYN16) (PE)

Gene Names
STX16; SYN16
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STX16; Monoclonal Antibody; STX16 (Syntaxin 16; Syntaxin-16; MGC90328; SYN16) (PE); anti-STX16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D12
Specificity
Recognizes human STX16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
304
Applicable Applications for anti-STX16 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from STX16 (NP_003754) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEH*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged STX16 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STX16 is 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of STX16 expression in transfected 293T cell line by STX16 monoclonal antibody Lane 1: STX16 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STX16 expression in transfected 293T cell line by STX16 monoclonal antibody Lane 1: STX16 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-STX16 antibody
This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-STX16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
syntaxin-16 isoform b
NCBI Official Synonym Full Names
syntaxin 16
NCBI Official Symbol
STX16
NCBI Official Synonym Symbols
SYN16
NCBI Protein Information
syntaxin-16
UniProt Protein Name
Syntaxin-16
Protein Family
UniProt Gene Name
STX16
UniProt Synonym Gene Names
Syn16

NCBI Description

This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011]

Uniprot Description

SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.

Research Articles on STX16

Similar Products

Product Notes

The STX16 stx16 (Catalog #AAA6160566) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STX16 (Syntaxin 16, Syntaxin-16, MGC90328, SYN16) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STX16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX16 stx16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STX16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.