Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-RAB38 Polyclonal Antibody)

Rabbit RAB38 Polyclonal Antibody | anti-RAB38 antibody

RAB38 Polyclonal Antibody

Gene Names
RAB38; rrGTPbp; NY-MEL-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RAB38; Polyclonal Antibody; RAB38 Polyclonal Antibody; NY-MEL-1; rrGTPbp; ras-related protein Rab-38; anti-RAB38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.45 mg/ml (varies by lot)
Sequence Length
211
Applicable Applications for anti-RAB38 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 92-211 of human RAB38 (NP_071732.1).
Immunogen Sequence
VTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Positive Samples
A375, MCF7, NIH/3T3, Mouse Ovary
Cellular Location
Cell Membrane, Cytoplasmic Side, Cytoplasmic Vesicle, Lipid-Anchor, Melanosome, Phagosome, Phagosome Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RAB38 Polyclonal Antibody)

Western Blot (WB) (Western blot-RAB38 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 23kDa
Observed: 25kDa
NCBI Official Full Name
ras-related protein Rab-38
NCBI Official Synonym Full Names
RAB38, member RAS oncogene family
NCBI Official Symbol
RAB38
NCBI Official Synonym Symbols
rrGTPbp; NY-MEL-1
NCBI Protein Information
ras-related protein Rab-38
UniProt Protein Name
Ras-related protein Rab-38
Protein Family
UniProt Gene Name
RAB38
UniProt Entry Name
RAB38_HUMAN

Uniprot Description

RAB38: May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Expressed in melanocytes. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: phagocytic vesicle membrane; membrane; endoplasmic reticulum; early endosome; melanosome; plasma membrane; phagocytic vesicle; trans-Golgi network; cytosol

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; GTP-dependent protein binding

Biological Process: intracellular protein transport; protein transport; platelet dense granule organization and biogenesis; metabolic process; small GTPase mediated signal transduction; Rab protein signal transduction

Research Articles on RAB38

Similar Products

Product Notes

The RAB38 rab38 (Catalog #AAA9140887) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB38 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RAB38 rab38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.