Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged STON1 is 1ng/ml as a capture antibody.)

Mouse anti-Human STON1 Monoclonal Antibody | anti-STON1 antibody

STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804) (HRP)

Gene Names
STON1; SALF; SBLF; STN1; STNB1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STON1; Monoclonal Antibody; STON1 (Stonin-1; Stoned B-like Factor; SALF; SBLF; STN1; DKFZp781K2462; MGC149803; MGC149804) (HRP); anti-STON1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes human SBLF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
735
Applicable Applications for anti-STON1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa529-621 from human SBLF (NP_006864) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged STON1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STON1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-STON1 antibody
This protein may be involved in the endocytic machinery.
Product Categories/Family for anti-STON1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
stonin-1
NCBI Official Synonym Full Names
stonin 1
NCBI Official Symbol
STON1
NCBI Official Synonym Symbols
SALF; SBLF; STN1; STNB1
NCBI Protein Information
stonin-1
UniProt Protein Name
Stonin-1
Protein Family
UniProt Gene Name
STON1
UniProt Synonym Gene Names
SALF; SBLF; STN1
UniProt Entry Name
STON1_HUMAN

NCBI Description

Endocytosis of cell surface proteins is mediated by a complex molecular machinery that assembles on the inner surface of the plasma membrane. This gene encodes one of two human homologs of the Drosophila melanogaster stoned B protein. This protein is related to components of the endocytic machinery and exhibits a modular structure consisting of an N-terminal proline-rich domain, a central region of homology specific to the human stoned B-like proteins, and a C-terminal region homologous to the mu subunits of adaptor protein (AP) complexes. Read-through transcription of this gene into the neighboring downstream gene, which encodes TFIIA-alpha/beta-like factor, generates a transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]

Uniprot Description

STON1: May be involved in the endocytic machinery. Belongs to the Stoned B family.

Chromosomal Location of Human Ortholog: 2p16.3

Cellular Component: clathrin adaptor complex

Biological Process: intracellular protein transport; regulation of endocytosis; endocytosis

Research Articles on STON1

Similar Products

Product Notes

The STON1 ston1 (Catalog #AAA6155255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STON1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STON1 ston1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STON1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.