Mouse anti-Human STK38L Monoclonal Antibody | anti-STK38L antibody

STK38L (Serine/Threonine-protein Kinase 38-like, NDR2 Protein Kinase, Nuclear Dbf2-related Kinase 2, KIAA0965, NDR2)

Cat. Num. AAA6011386

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: STK38L; Monoclonal Antibody; STK38L (Serine/Threonine-protein Kinase 38-like; NDR2 Protein Kinase; Nuclear Dbf2-related Kinase 2; KIAA0965; NDR2); Anti -STK38L (Serine/Threonine-protein Kinase 38-like; anti-STK38L antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E5
• Specificity: Recognizes human STK38L.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPP

• Applicable Applications for anti-STK38L antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full-length recombinant protein corresponding to aa1-465 from STK38L (AAH28603) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (77.15kD).)

Western Blot (WB)

(Western Blot analysis of STK38L expression in transfected 293T cell line by STK38L monoclonal antibody.|Lane 1: STK38L transfected lysate (54kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK38L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Related Product Information for anti-STK38L antibody

STK38L contains 12 protein kinase catalytic subdomains and a potential bipartite nuclear localization signal. Northern blot analysis revealed expression of a 3.9kb transcript in all tissues tested, with the possible exception of adult brain. Highest expression was in peripheral blood leukocytes. Immunoblot and immunofluorescence microscopy demonstrated predominantly nuclear expression of a 55kD protein.

Product Categories/Family for anti-STK38L antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 548923810
• NCBI GeneID: 477663
• NCBI Accession #: NP_001271419.1
• NCBI GenBank Nucleotide #: NM_001284490.1
• NCBI Official Full Name: serine/threonine-protein kinase 38-like
• NCBI Official Symbol: STK38L
• NCBI Protein Information: serine/threonine-protein kinase 38-like
• Protein Family: Serine/threonine-protein kinase