Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (77.15kD).)

Mouse anti-Human STK38L Monoclonal Antibody | anti-STK38L antibody

STK38L (Serine/Threonine-protein Kinase 38-like, NDR2 Protein Kinase, Nuclear Dbf2-related Kinase 2, KIAA0965, NDR2) (AP)

Gene Names
STK38L; NDR2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK38L; Monoclonal Antibody; STK38L (Serine/Threonine-protein Kinase 38-like; NDR2 Protein Kinase; Nuclear Dbf2-related Kinase 2; KIAA0965; NDR2) (AP); anti-STK38L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E5
Specificity
Recognizes human STK38L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STK38L antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-465 from STK38L (AAH28603) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (77.15kD).)

Western Blot (WB) (Western Blot detection against Immunogen (77.15kD).)

Western Blot (WB)

(Western Blot analysis of STK38L expression in transfected 293T cell line by STK38L monoclonal antibody. Lane 1: STK38L transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STK38L expression in transfected 293T cell line by STK38L monoclonal antibody. Lane 1: STK38L transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK38L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STK38L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])
Product Categories/Family for anti-STK38L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43,170 Da
NCBI Official Full Name
Homo sapiens serine/threonine kinase 38 like, mRNA
NCBI Official Synonym Full Names
serine/threonine kinase 38 like
NCBI Official Symbol
STK38L
NCBI Official Synonym Symbols
NDR2
NCBI Protein Information
serine/threonine-protein kinase 38-like

Research Articles on STK38L

Similar Products

Product Notes

The STK38L (Catalog #AAA6134039) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK38L (Serine/Threonine-protein Kinase 38-like, NDR2 Protein Kinase, Nuclear Dbf2-related Kinase 2, KIAA0965, NDR2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK38L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK38L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK38L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.