Mouse anti-Human STK38 Monoclonal Antibody | anti-STK38 antibody

STK38 (Serine/Threonine-protein Kinase 38, NDR1 Protein Kinase, Nuclear Dbf2-related Kinase 1, NDR1) (HRP)

Cat. Num. AAA6155250

• Gene Names: STK38; NDR; NDR1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STK38; Monoclonal Antibody; STK38 (Serine/Threonine-protein Kinase 38; NDR1 Protein Kinase; Nuclear Dbf2-related Kinase 1; NDR1) (HRP); anti-STK38 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G8-1F3
• Specificity: Recognizes human STK38.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STK38 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-466 from STK38 (AAH12085) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody Lane 1: STK38 transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(STK38 monoclonal antibody Western Blot analysis of STK38 expression in human kidney.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of STK38 transfected lysate using STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (77.26kD).)

Product Categories/Family for anti-STK38 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 15082349
• NCBI GeneID: 11329
• Molecular Weight: 54,190 Da
• NCBI Official Full Name: Homo sapiens serine/threonine kinase 38, mRNA
• NCBI Official Synonym Full Names: serine/threonine kinase 38
• NCBI Official Symbol: STK38
• NCBI Official Synonym Symbols: NDR; NDR1
• NCBI Protein Information: serine/threonine-protein kinase 38
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]