Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Mouse anti-Human BHLHE41 Monoclonal Antibody | anti-BHLHE41 antibody

BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai

Gene Names
BHLHE41; DEC2; hDEC2; BHLHB3; SHARP1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BHLHE41; Monoclonal Antibody; BHLHE41 (BHLHB3; Class E Basic Helix-loop-helix Protein 41; bHLHe41; Class B Basic Helix-loop-helix Protein 3; bHLHb3; Differentially Expressed in Chondrocytes Protein 2; hDEC2; Enhancer-of-split and Hai; anti-BHLHE41 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H6
Specificity
Recognizes human BHLHB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-BHLHE41 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa203-283 from human BHLHB3 (NP_110389) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.91kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged BHLHE41 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BHLHE41 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-BHLHE41 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
class E basic helix-loop-helix protein 41
NCBI Official Synonym Full Names
basic helix-loop-helix family member e41
NCBI Official Symbol
BHLHE41
NCBI Official Synonym Symbols
DEC2; hDEC2; BHLHB3; SHARP1
NCBI Protein Information
class E basic helix-loop-helix protein 41
UniProt Protein Name
Class E basic helix-loop-helix protein 41
UniProt Gene Name
BHLHE41
UniProt Synonym Gene Names
BHLHB3; DEC2; SHARP1; bHLHe41; bHLHb3; hDEC2; SHARP-1
UniProt Entry Name
BHE41_HUMAN

NCBI Description

This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. Defects in this gene are associated with the short sleep phenotype. [provided by RefSeq, Feb 2014]

Uniprot Description

BHLHB3: May be a transcriptional repressor that represses both basal and activated transcription. Homodimerize.

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; MRF binding; protein binding; protein homodimerization activity; protein heterodimerization activity; histone deacetylase binding; bHLH transcription factor binding; transcription corepressor activity

Biological Process: circadian rhythm; transcription from RNA polymerase II promoter; cell proliferation; organ morphogenesis; negative regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; cell differentiation

Disease: Short Sleeper

Research Articles on BHLHE41

Similar Products

Product Notes

The BHLHE41 bhlhe41 (Catalog #AAA6146127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BHLHE41 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BHLHE41 bhlhe41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BHLHE41, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.