Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STK38 rabbit polyclonal antibody. Western Blot analysis of STK38 expression in mouse liver.)

Rabbit anti-Human, Mouse STK38 Polyclonal Antibody | anti-STK38 antibody

STK38 (Serine/Threonine-protein Kinase 38, NDR1 Protein Kinase, Nuclear Dbf2-related Kinase 1, NDR1) APC

Gene Names
STK38; NDR; NDR1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK38; Polyclonal Antibody; STK38 (Serine/Threonine-protein Kinase 38; NDR1 Protein Kinase; Nuclear Dbf2-related Kinase 1; NDR1) APC; anti-STK38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STK38. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-STK38 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human STK38, aa1-465 (NP_009202.1).
Immunogen Sequence
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STK38 rabbit polyclonal antibody. Western Blot analysis of STK38 expression in mouse liver.)

Western Blot (WB) (STK38 rabbit polyclonal antibody. Western Blot analysis of STK38 expression in mouse liver.)

Western Blot (WB)

(STK38 rabbit polyclonal antibody. Western Blot analysis of STK38 expression in NIH/3T3.)

Western Blot (WB) (STK38 rabbit polyclonal antibody. Western Blot analysis of STK38 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 polyclonal antibody. Lane 1: STK38 transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 polyclonal antibody. Lane 1: STK38 transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-STK38 antibody
NDR is a nuclear NDR/LATS serine/threonine kinase. Ndr kinases are endogenous inhibitors of neurite initiation and cell spreading.
Product Categories/Family for anti-STK38 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,190 Da
NCBI Official Full Name
serine/threonine-protein kinase 38
NCBI Official Synonym Full Names
serine/threonine kinase 38
NCBI Official Symbol
STK38
NCBI Official Synonym Symbols
NDR; NDR1
NCBI Protein Information
serine/threonine-protein kinase 38; STK38; NDR1 protein kinase; nuclear Dbf2-related 1; nuclear Dbf2-related kinase 1; Ndr Ser/Thr kinase-like protein; serine threonine protein kinase
UniProt Protein Name
Serine/threonine-protein kinase 38
UniProt Gene Name
STK38
UniProt Entry Name
STK38_HUMAN

NCBI Description

This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

NDR1: is an AGC kinase of the NDR family. An apparent upstream regulator of Myc activity in human B-cell lymphoma. Mediates apoptosis downstream of the tumor suppressor proteins RASSF1A and MST1. Reduced expression of NDR1 results in defective apoptotic responses and a predisposition to develop T cell lymphoma in mice. Activated by binding of S100B which releases autoinhibitory N-lobe interactions. Ubiquitously expressed with highest levels observed in peripheral blood leukocytes.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Protein kinase, AGC; AGC group; NDR family

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; mitogen-activated protein kinase kinase kinase binding; ATP binding

Biological Process: negative regulation of MAP kinase activity; protein modification process; protein amino acid phosphorylation

Research Articles on STK38

Similar Products

Product Notes

The STK38 stk38 (Catalog #AAA6395423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK38 (Serine/Threonine-protein Kinase 38, NDR1 Protein Kinase, Nuclear Dbf2-related Kinase 1, NDR1) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STK38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK38 stk38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.