Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7.Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa).Lane 2: Non-transfected lysate.)

Mouse STAU2 Monoclonal Antibody | anti-STAU2 antibody

STAU2 (Staufen, RNA Binding Protein, Homolog 2 (Drosophila), 39K2, 39K3, DKFZp781K0371, MGC119606) (FITC)

Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
STAU2; Monoclonal Antibody; STAU2 (Staufen; RNA Binding Protein; Homolog 2 (Drosophila); 39K2; 39K3; DKFZp781K0371; MGC119606) (FITC); Staufen; MGC119606; anti-STAU2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B7
Specificity
Recognizes STAU2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
479
Applicable Applications for anti-STAU2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STAU2 (NP_055208, 341aa-440aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7.Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7.Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])
Related Product Information for anti-STAU2 antibody
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-STAU2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
double-stranded RNA-binding protein Staufen homolog 2 isoform e
UniProt Protein Name
Double-stranded RNA-binding protein Staufen homolog 2
UniProt Gene Name
STAU2
UniProt Entry Name
STAU2_HUMAN

Uniprot Description

STAU2: RNA-binding protein required for the microtubule- dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: microtubule; membrane; endoplasmic reticulum; nucleolus

Molecular Function: protein binding; double-stranded RNA binding

Biological Process: transport

Similar Products

Product Notes

The STAU2 stau2 (Catalog #AAA6176613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STAU2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAU2 stau2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAU2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.