Mouse STAU2 Monoclonal Antibody | anti-STAU2 antibody

STAU2 (Staufen, RNA Binding Protein, Homolog 2 (Drosophila), 39K2, 39K3, DKFZp781K0371, MGC119606) (Biotin)

Cat. Num. AAA6172203

• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: STAU2; Monoclonal Antibody; STAU2 (Staufen; RNA Binding Protein; Homolog 2 (Drosophila); 39K2; 39K3; DKFZp781K0371; MGC119606) (Biotin); Staufen; MGC119606; anti-STAU2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B7
• Specificity: Recognizes STAU2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 479

• Applicable Applications for anti-STAU2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: STAU2 (NP_055208, 341aa-440aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M14), clone 3B7.Lane 1: STAU2 transfected lysate (Predicted MW: 52.8 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAU2 on HeLa cell. [antibody concentration 15 ug/ml])

Related Product Information for anti-STAU2 antibody

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-STAU2 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 256418993
• NCBI Accession #: NP_055208
• NCBI GenBank Nucleotide #: NP_055208.2
• UniProt Accession #: Q9NUL3
• NCBI Official Full Name: double-stranded RNA-binding protein Staufen homolog 2 isoform e
• UniProt Protein Name: Double-stranded RNA-binding protein Staufen homolog 2
• Protein Family: Double-stranded RNA-binding protein
• UniProt Gene Name: STAU2
• UniProt Entry Name: STAU2_HUMAN

Uniprot Description

STAU2: RNA-binding protein required for the microtubule- dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: microtubule; membrane; endoplasmic reticulum; nucleolus

Molecular Function: protein binding; double-stranded RNA binding

Biological Process: transport