Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human STAP1 Monoclonal Antibody | anti-STAP1 antibody

STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (PE)

Gene Names
STAP1; BRDG1; STAP-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAP1; Monoclonal Antibody; STAP1 (BRDG1; Signal-transducing Adaptor Protein 1; Stem Cell Adaptor Protein 1; BCR Downstream-signaling Protein 1; Docking Protein BRDG1) (PE); anti-STAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5A10
Specificity
Recognizes human BRDG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-STAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa186-294 from human BRDG1 (NP_036240) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of BRDG1 expression in transfected 293T cell line by BRDG1 monoclonal antibody. Lane 1: BRDG1 transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BRDG1 expression in transfected 293T cell line by BRDG1 monoclonal antibody. Lane 1: BRDG1 transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-STAP1 antibody
STAP1 functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity.
Product Categories/Family for anti-STAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.8 kDa (319aa), confirmed by MALDI-TOF
NCBI Official Full Name
signal-transducing adaptor protein 1
NCBI Official Synonym Full Names
signal transducing adaptor family member 1
NCBI Official Symbol
STAP1
NCBI Official Synonym Symbols
BRDG1; STAP-1
NCBI Protein Information
signal-transducing adaptor protein 1
UniProt Protein Name
Signal-transducing adaptor protein 1
UniProt Gene Name
STAP1
UniProt Synonym Gene Names
BRDG1; STAP-1
UniProt Entry Name
STAP1_HUMAN

NCBI Description

The protein encoded by this gene contains a proline-rich region, a pleckstrin homology (PH) domain, and a region in the carboxy terminal half with similarity to the Src Homology 2 (SH2) domain. This protein is a substrate of tyrosine-protein kinase Tec, and its interaction with tyrosine-protein kinase Tec is phosphorylation-dependent. This protein is thought to participate in a positive feedback loop by upregulating the activity of tyrosine-protein kinase Tec. Variants of this gene have been associated with autosomal-dominant hypercholesterolemia (ADH), which is characterized by elevated low-density lipoprotein cholesterol levels and in increased risk of coronary vascular disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

STAP1: an adaptor protein which contains pleckstrin homology (PH) and Src homology 2-like (SRC) domains and a proline-rich region. Induced in activated bone marrow-derived macrophages, and by CpG, LPS, and interferon in myeloid cell lines. Induces pro-inflammatory responses and may contribute to neuronal apoptosis and degeneration. Overexpressed, it interacts with the CSFR, inhibiting its ligand-dependent phosphorylation. Its expression inhibits cellular migration and can increase cytotoxicity against 661W photoreceptor like cells.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q13.2

Cellular Component: protein complex; mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; SH3/SH2 adaptor activity

Biological Process: intracellular protein transport; positive regulation of signal transduction; signal transduction; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on STAP1

Similar Products

Product Notes

The STAP1 stap1 (Catalog #AAA6160527) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAP1 stap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.