Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human STAM2 Monoclonal Antibody | anti-STAM2 antibody

STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP)

Gene Names
STAM2; Hbp; STAM2A; STAM2B
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
STAM2; Monoclonal Antibody; STAM2 (Signal Transducing Adapter Molecule 2; STAM-2; Hrs-binding Protein; HBP); Anti -STAM2 (Signal Transducing Adapter Molecule 2; anti-STAM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A10
Specificity
Recognizes human STAM2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
Applicable Applications for anti-STAM2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation, ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa416-525 from STAM2 (NP_005834) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(STAM2 monoclonal antibody Western Blot analysis of STAM2 expression in HeLa.)

Western Blot (WB) (STAM2 monoclonal antibody Western Blot analysis of STAM2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of STAM2 expression in transfected 293T cell line by STAM2 monoclonal antibody |Lane 1: STAM2 transfected lysate (Predicted MW: 58.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STAM2 expression in transfected 293T cell line by STAM2 monoclonal antibody |Lane 1: STAM2 transfected lysate (Predicted MW: 58.2kD).|Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of STAM2 transfected lysate using STAM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STAM2 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of STAM2 transfected lysate using STAM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STAM2 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged STAM2 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAM2 is ~10ng/ml as a capture antibody.)
Product Categories/Family for anti-STAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,164 Da
NCBI Official Full Name
signal transducing adapter molecule 2
NCBI Official Synonym Full Names
signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
NCBI Official Symbol
STAM2
NCBI Official Synonym Symbols
Hbp; STAM2A; STAM2B
NCBI Protein Information
signal transducing adapter molecule 2; STAM-2; HSE1 homolog; Hrs-binding protein; STAM-like protein containing SH3 and ITAM domains 2
UniProt Protein Name
Signal transducing adapter molecule 2
UniProt Gene Name
STAM2
UniProt Synonym Gene Names
HBP; STAM-2
UniProt Entry Name
STAM2_HUMAN

NCBI Description

The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM, this protein acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. This protein and STAM thus are thought to exhibit compensatory effects on the signaling pathway downstream of JAK kinases upon cytokine stimulation. [provided by RefSeq, Jul 2008]

Uniprot Description

STAM2: an adaptor protein involved in the downstream signaling of cytokine receptors. Contain a SH3 domain and immunoreceptor tyrosine-based activation motif (ITAM). Acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. May modulate the signaling pathway downstream of JAK kinases upon cytokine stimulation.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 2q23.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; early endosome membrane; cytoplasm; cytosol

Molecular Function: protein binding

Biological Process: negative regulation of epidermal growth factor receptor signaling pathway; epidermal growth factor receptor signaling pathway; intracellular protein transport; endosome transport

Research Articles on STAM2

Similar Products

Product Notes

The STAM2 stam2 (Catalog #AAA6006943) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Immunoprecipitation, ELISA and Western Blot. Researchers should empirically determine the suitability of the STAM2 stam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QSYSLGPDQI GPLRSLPPNV NSSVTAQPAQ TSYLSTGQDT VSNPTYMNQN SNLQSATGTT AYTQQMGMSV DMSSYQNTTS NLPQLAGFPV TVPAHPVAQQ HTNYHQQPLL. It is sometimes possible for the material contained within the vial of "STAM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.