Mouse anti-Human STAM Monoclonal Antibody | anti-STAM antibody

STAM (Signal Transducing Adapter Molecule 1, STAM1, STAM-1) (HRP)

Cat. Num. AAA6155221

• Gene Names: STAM; STAM1; STAM-1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STAM; Monoclonal Antibody; STAM (Signal Transducing Adapter Molecule 1; STAM1; STAM-1) (HRP); anti-STAM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B11-1G1
• Specificity: Recognizes human STAM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STAM antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-404 from STAM (AAH30586) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.44kD).)

Western Blot (WB)

(Western Blot analysis of STAM expression in transfected 293T cell line by STAM monoclonal antibody Lane 1: STAM transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of STAM transfected lysate using STAM monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STAM monoclonal antibody. Protocol Download)

Product Categories/Family for anti-STAM antibody

Antibodies; Adapter Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 34192153
• NCBI GeneID: 8027
• Molecular Weight: 44,972 Da
• NCBI Official Full Name: Homo sapiens signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, mRNA
• NCBI Official Synonym Full Names: signal transducing adaptor molecule
• NCBI Official Symbol: STAM
• NCBI Official Synonym Symbols: STAM1; STAM-1
• NCBI Protein Information: signal transducing adapter molecule 1
• Protein Family: STAM-binding protein

NCBI Description

This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]