Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human STAM Monoclonal Antibody | anti-STAM antibody

STAM (Signal Transducing Adapter Molecule 1, STAM1, STAM-1) (FITC)

Gene Names
STAM; STAM1; STAM-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAM; Monoclonal Antibody; STAM (Signal Transducing Adapter Molecule 1; STAM1; STAM-1) (FITC); anti-STAM antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B11-1G1
Specificity
Recognizes human STAM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-STAM antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-404 from STAM (AAH30586) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.44kD).)

Western Blot (WB)

(Western Blot analysis of STAM expression in transfected 293T cell line by STAM monoclonal antibody Lane 1: STAM transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of STAM transfected lysate using STAM monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STAM monoclonal antibody. Protocol Download)

Product Categories/Family for anti-STAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
44,972 Da
NCBI Official Full Name
Homo sapiens signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, mRNA
NCBI Official Synonym Full Names
signal transducing adaptor molecule
NCBI Official Symbol
STAM
NCBI Official Synonym Symbols
STAM1; STAM-1
NCBI Protein Information
signal transducing adapter molecule 1
Protein Family

NCBI Description

This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]

Research Articles on STAM

Similar Products

Product Notes

The STAM (Catalog #AAA6149918) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAM (Signal Transducing Adapter Molecule 1, STAM1, STAM-1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAM can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAM for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual