Mouse anti-Human SSR4 Monoclonal Antibody | anti-ssr4 antibody

SSR4 (TRAPD, Translocon-associated Protein Subunit delta, Signal Sequence Receptor Subunit delta)

Cat. Num. AAA6009598

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SSR4; Monoclonal Antibody; SSR4 (TRAPD; Translocon-associated Protein Subunit delta; Signal Sequence Receptor Subunit delta); Anti -SSR4 (TRAPD; anti-ssr4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D3
• Specificity: Recognizes human SSR4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA*

• Applicable Applications for anti-ssr4 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunofluorescence.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length recombinant corresponding to aa24-174 from human SSR4 (AAH03371) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.61kD).)

Western Blot (WB)

(SSR4 monoclonal antibody, Western Blot analysis of SSR4 expression in C32.)

Western Blot (WB)

(Western Blot analysis of SSR4 expression in transfected 293T cell line by SSR4 monoclonal antibody.|Lane 1: SSR4 transfected lysate (19kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SSR4 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-ssr4 antibody

SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.

Product Categories/Family for anti-ssr4 antibody

Antibodies; Abs to Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 19112609
• NCBI GeneID: 2541301
• NCBI Accession #: NP_595817.1
• NCBI GenBank Nucleotide #: NM_001021721.2
• UniProt Accession #: Q9P7Y0
• Molecular Weight: 44,255 Da
• NCBI Official Full Name: SWI/SNF and RSC complex subunit Ssr4
• NCBI Official Symbol: ssr4
• NCBI Protein Information: SWI/SNF and RSC complex subunit Ssr4
• UniProt Protein Name: SWI/SNF and RSC complexes subunit ssr4
• Protein Family: SWI/SNF and RSC complexes
• UniProt Gene Name: ssr4
• UniProt Entry Name: SSR4_SCHPO

Uniprot Description

Function: Component of the chromatin structure remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. Controls particularly membrane and organelle development genes. Part of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. Ref.3

Subunit structure: Component of the RSC complex composed of at least arp9, arp42, rsc1, rsc4, rsc7, rsc9, rsc58, sfh1, snf21, ssr1, ssr2, ssr3 and ssr4. The complex interacts with histone and histone variant components of centromeric chromatin

By similarity. Component of the SWI/SNF global transcription activator complex composed of at least arp9, arp42, snf5, snf22, snf30, sbf59, sol1, ssr1, ssr2, ssr3, ssr4 and tfg3. Ref.3

Subcellular location: Cytoplasm. Nucleus Ref.2.

Sequence similarities: Belongs to the SSR4 family.