Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (42.61kD).)

Mouse anti-Human SSR4 Monoclonal Antibody | anti-SSR4 antibody

SSR4 (TRAPD, Translocon-associated Protein Subunit delta, Signal Sequence Receptor Subunit delta) (FITC)

Gene Names
SSR4; CDG1Y; TRAPD
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SSR4; Monoclonal Antibody; SSR4 (TRAPD; Translocon-associated Protein Subunit delta; Signal Sequence Receptor Subunit delta) (FITC); anti-SSR4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D3
Specificity
Recognizes human SSR4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
622
Applicable Applications for anti-SSR4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa24-174 from human SSR4 (AAH03371) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.61kD).)

Western Blot (WB) (Western Blot detection against Immunogen (42.61kD).)

Western Blot (WB)

(SSR4 monoclonal antibody, Western Blot analysis of SSR4 expression in C32.)

Western Blot (WB) (SSR4 monoclonal antibody, Western Blot analysis of SSR4 expression in C32.)

Western Blot (WB)

(Western Blot analysis of SSR4 expression in transfected 293T cell line by SSR4 monoclonal antibody. Lane 1: SSR4 transfected lysate (19kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SSR4 expression in transfected 293T cell line by SSR4 monoclonal antibody. Lane 1: SSR4 transfected lysate (19kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SSR4 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SSR4 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SSR4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens signal sequence receptor, delta (translocon-associated protein delta), mRNA
NCBI Official Synonym Full Names
signal sequence receptor subunit 4
NCBI Official Symbol
SSR4
NCBI Official Synonym Symbols
CDG1Y; TRAPD
NCBI Protein Information
translocon-associated protein subunit delta
Protein Family

NCBI Description

This gene encodes the delta subunit of the translocon-associated protein complex which is involved in translocating proteins across the endoplasmic reticulum membrane. The encoded protein is located in the Xq28 region and is arranged in a compact head-to-head manner with the isocitrate dehydrogenase 3 (NAD+) gamma gene and both genes are driven by a CpG-embedded bidirectional promoter. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2011]

Research Articles on SSR4

Similar Products

Product Notes

The SSR4 (Catalog #AAA6149902) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSR4 (TRAPD, Translocon-associated Protein Subunit delta, Signal Sequence Receptor Subunit delta) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSR4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SSR4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SSR4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.