Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.27kD).)

Mouse anti-Human SPINK1 Monoclonal Antibody | anti-SPINK1 antibody

SPINK1 (Pancreatic Secretory Trypsin Inhibitor, Serine Protease Inhibitor Kazal-type 1, Tumor-associated Trypsin Inhibitor, TATI, PSTI) (PE)

Gene Names
SPINK1; TCP; PCTT; PSTI; TATI; Spink3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPINK1; Monoclonal Antibody; SPINK1 (Pancreatic Secretory Trypsin Inhibitor; Serine Protease Inhibitor Kazal-type 1; Tumor-associated Trypsin Inhibitor; TATI; PSTI) (PE); anti-SPINK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D4
Specificity
Recognizes human SPINK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SPINK1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-80 from human SPINK1 (AAH25790) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.27kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.27kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of SPINK1 transfected lysate using SPINK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SPINK1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SPINK1 transfected lysate using SPINK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SPINK1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SPINK1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPINK1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SPINK1 antibody
References
1. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Han B, Mehra R, Suleman K, Tomlins SA, Wang L, Singhal N, Linetzky KA, Palanisamy N, Zhou M, Chinnaiyan AM, Shah RB.Mod Pathol. 2009 Sep;22(9):1176-85. Epub 2009 May 22. 2. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Tomlins SA, Rhodes DR, Yu J, Varambally S, Mehra R, Perner S, Demichelis F, Helgeson BE, Laxman B, Morris DS, Cao Q, Cao X, Andren O, Fall K, Johnson L, Wei JT, Shah RB, Al-Ahmadie H, Eastham JA, Eggener SE, Fine SW, Hotakainen K, Stenman UH, Tsodikov A,Cancer Cell. 2008 Jun;13(6):519-28.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
8,507 Da
NCBI Official Full Name
Homo sapiens serine peptidase inhibitor, Kazal type 1, mRNA
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 1
NCBI Official Symbol
SPINK1
NCBI Official Synonym Symbols
TCP; PCTT; PSTI; TATI; Spink3
NCBI Protein Information
serine protease inhibitor Kazal-type 1
Protein Family

NCBI Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008]

Research Articles on SPINK1

Similar Products

Product Notes

The SPINK1 (Catalog #AAA6160468) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPINK1 (Pancreatic Secretory Trypsin Inhibitor, Serine Protease Inhibitor Kazal-type 1, Tumor-associated Trypsin Inhibitor, TATI, PSTI) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPINK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPINK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPINK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.