Mouse anti-Human SPINK1 Monoclonal Antibody | anti-SPINK1 antibody

SPINK1 (Pancreatic Secretory Trypsin Inhibitor, Serine Protease Inhibitor Kazal-type 1, Tumor-associated Trypsin Inhibitor, TATI, PSTI) (AP)

Cat. Num. AAA6133953

• Gene Names: SPINK1; TCP; PCTT; PSTI; TATI; Spink3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SPINK1; Monoclonal Antibody; SPINK1 (Pancreatic Secretory Trypsin Inhibitor; Serine Protease Inhibitor Kazal-type 1; Tumor-associated Trypsin Inhibitor; TATI; PSTI) (AP); anti-SPINK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D4
• Specificity: Recognizes human SPINK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SPINK1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa24-80 from human SPINK1 (AAH25790) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.27kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of SPINK1 transfected lysate using SPINK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SPINK1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SPINK1 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SPINK1 antibody

Antibodies; Protease Inhibitors

References

1. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Han B, Mehra R, Suleman K, Tomlins SA, Wang L, Singhal N, Linetzky KA, Palanisamy N, Zhou M, Chinnaiyan AM, Shah RB.Mod Pathol. 2009 Sep;22(9):1176-85. Epub 2009 May 22. 2. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Tomlins SA, Rhodes DR, Yu J, Varambally S, Mehra R, Perner S, Demichelis F, Helgeson BE, Laxman B, Morris DS, Cao Q, Cao X, Andren O, Fall K, Johnson L, Wei JT, Shah RB, Al-Ahmadie H, Eastham JA, Eggener SE, Fine SW, Hotakainen K, Stenman UH, Tsodikov A,Cancer Cell. 2008 Jun;13(6):519-28.

NCBI and Uniprot Product Information

• NCBI GI #: 19343607
• NCBI GeneID: 6690
• Molecular Weight: 8,507 Da
• NCBI Official Full Name: Homo sapiens serine peptidase inhibitor, Kazal type 1, mRNA
• NCBI Official Synonym Full Names: serine peptidase inhibitor, Kazal type 1
• NCBI Official Symbol: SPINK1
• NCBI Official Synonym Symbols: TCP; PCTT; PSTI; TATI; Spink3
• NCBI Protein Information: serine protease inhibitor Kazal-type 1
• Protein Family: Serine protease inhibitor

NCBI Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008]