Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SPAST monoclonal antibody (M02), clone 2F5. Western Blot analysis of SPAST expression in Jurkat.)

Mouse SPAST Monoclonal Antibody | anti-SPAST antibody

SPAST (spastin, ADPSP, FSP2, KIAA1083, SPG4) (AP)

Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
SPAST; Monoclonal Antibody; SPAST (spastin; ADPSP; FSP2; KIAA1083; SPG4) (AP); spastin; SPG4; anti-SPAST antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F5
Specificity
Recognizes SPAST.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
616
Applicable Applications for anti-SPAST antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SPAST (NP_055761, 200aa-304aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SPAST monoclonal antibody (M02), clone 2F5. Western Blot analysis of SPAST expression in Jurkat.)

Western Blot (WB) (SPAST monoclonal antibody (M02), clone 2F5. Western Blot analysis of SPAST expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SPAST on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ~ 10 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SPAST on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ~ 10 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SPAST on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ~ 10 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SPAST on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ~ 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SPAST on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SPAST on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SPAST on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SPAST on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SPAST antibody
This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. [provided by RefSeq]
Product Categories/Family for anti-SPAST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
spastin isoform 1
UniProt Protein Name
Spastin
Protein Family
UniProt Gene Name
SPAST
UniProt Entry Name
SPAST_HUMAN

Uniprot Description

spastin: ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. May also play a role in axon growth and the formation of axonal branches. Defects in SPAST are the cause of spastic paraplegia autosomal dominant type 4 (SPG4). Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. SPG4 is the most common form of autosomal dominant spastic paraplegias. Belongs to the AAA ATPase family. Spastin subfamily. 4 isoforms of the human protein are produced by alternative promoter.

Protein type: Cytoskeletal; EC 3.6.4.3; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p24-p21

Cellular Component: microtubule cytoskeleton; centrosome; microtubule; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; integral to membrane; spindle; cytoplasmic vesicle; midbody; nucleus; endosome

Molecular Function: protein binding; microtubule binding; beta-tubulin binding; microtubule-severing ATPase activity; ATP binding; alpha-tubulin binding

Biological Process: positive regulation of microtubule depolymerization; ER to Golgi vesicle-mediated transport; axonogenesis; metabolic process; microtubule severing; cytoplasmic microtubule organization and biogenesis; microtubule bundle formation; protein homooligomerization

Disease: Spastic Paraplegia 4, Autosomal Dominant

Similar Products

Product Notes

The SPAST spast (Catalog #AAA6164007) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SPAST can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPAST spast for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPAST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.