Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SP100 is approximately 0.3ng/ml as a capture antibody.)

Mouse SP100 Monoclonal Antibody | anti-SP100 antibody

SP100 (SP100 Nuclear antigen, DKFZp686E07254, FLJ00340, FLJ34579) (FITC)

Gene Names
SP100; lysp100b
Applications
Western Blot
Purity
Purified
Synonyms
SP100; Monoclonal Antibody; SP100 (SP100 Nuclear antigen; DKFZp686E07254; FLJ00340; FLJ34579) (FITC); SP100 Nuclear antigen; FLJ34579; anti-SP100 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
200
Specificity
Recognizes SP100.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SP100 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SP100 (NP_003104, 1aa-98aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SP100 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SP100 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SP100 antibody
Mouse monoclonal antibody raised against a partial recombinant SP100.
Product Categories/Family for anti-SP100 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
nuclear autoantigen Sp-100 isoform 2
NCBI Official Synonym Full Names
SP100 nuclear antigen
NCBI Official Symbol
SP100
NCBI Official Synonym Symbols
lysp100b
NCBI Protein Information
nuclear autoantigen Sp-100
UniProt Protein Name
Nuclear autoantigen Sp-100
Protein Family
UniProt Gene Name
SP100
UniProt Entry Name
SP100_HUMAN

NCBI Description

This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein. [provided by RefSeq, Aug 2011]

Uniprot Description

SP100: May play a role in the control of gene expression. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: nucleoplasm; PML body; Mre11 complex; cytoplasm; nucleolus; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein homodimerization activity; DNA binding; transcription coactivator activity; chromatin binding; kinase binding; transcription factor binding; transcription corepressor activity

Biological Process: retinoic acid receptor signaling pathway; negative regulation of protein export from nucleus; response to retinoic acid; transcription, DNA-dependent; viral reproduction; negative regulation of transcription factor activity; positive regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; negative regulation of cell motility; negative regulation of transcription from RNA polymerase II promoter; regulation of angiogenesis; negative regulation of DNA binding; chromatin remodeling; negative regulation of viral transcription; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; response to cytokine stimulus; positive regulation of transcription factor activity; negative regulation of transcription, DNA-dependent; telomere maintenance

Research Articles on SP100

Similar Products

Product Notes

The SP100 sp100 (Catalog #AAA6177033) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SP100 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SP100 sp100 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP100, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.