Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SP1 monoclonal antibody (M08), clone 2G5 Western Blot analysis of SP1 expression in HeLa (Cat # L013V1).)

Mouse SP1 Monoclonal Antibody | anti-SP1 antibody

SP1 (Sp1 Transcription Factor) (FITC)

Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SP1; Monoclonal Antibody; SP1 (Sp1 Transcription Factor) (FITC); Sp1 Transcription Factor; anti-SP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G5
Specificity
Recognizes SP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SP1 (NP_612482, 522aa-618aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SP1 monoclonal antibody (M08), clone 2G5 Western Blot analysis of SP1 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (SP1 monoclonal antibody (M08), clone 2G5 Western Blot analysis of SP1 expression in HeLa (Cat # L013V1).)

Western Blot (WB)

(SP1 monoclonal antibody (M08), clone 2G5. Western Blot analysis of SP1 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (SP1 monoclonal antibody (M08), clone 2G5. Western Blot analysis of SP1 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(SP1 monoclonal antibody (M08), clone 2G5. Western Blot analysis of SP1 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (SP1 monoclonal antibody (M08), clone 2G5. Western Blot analysis of SP1 expression in Raw 264.7 (Cat # L024V1).)
Related Product Information for anti-SP1 antibody
Mouse monoclonal antibody raised against a full length recombinant SP1.
Product Categories/Family for anti-SP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,824 Da
NCBI Official Full Name
transcription factor Sp1 isoform a
NCBI Official Synonym Full Names
Sp1 transcription factor
NCBI Official Symbol
SP1
NCBI Protein Information
transcription factor Sp1
UniProt Protein Name
Transcription factor Sp1
UniProt Gene Name
SP1
UniProt Synonym Gene Names
TSFP1
UniProt Entry Name
SP1_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Uniprot Description

SP1: a transcription factor of the Sp1 C2H2-type zinc-finger protein family. Phosphorylated and activated by MAPK. Dephosphorylation by PTEN inhibits DNA binding. Binds to p38 in the nucleus. Interacts with Huntingtin and TAFII130. Transcriptional activity of SP1 and TAFII130 disrupted in early Huntingtin's Disease.

Protein type: DNA-binding; Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein C-terminus binding; histone acetyltransferase binding; protein binding; protein homodimerization activity; DNA binding; sequence-specific DNA binding; metal ion binding; histone deacetylase binding; double-stranded DNA binding; bHLH transcription factor binding; transcription factor binding; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; ossification; embryonic placenta development; transcription, DNA-dependent; viral reproduction; megakaryocyte differentiation; embryonic skeletal development; positive regulation of transcription, DNA-dependent; embryonic process involved in female pregnancy; rhythmic process; cellular lipid metabolic process; enucleate erythrocyte differentiation; liver development; trophectodermal cell differentiation; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; embryonic camera-type eye morphogenesis; lung development

Research Articles on SP1

Similar Products

Product Notes

The SP1 sp1 (Catalog #AAA6175797) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SP1 sp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.