Mouse SOX5 Monoclonal Antibody | anti-SOX5 antibody

SOX5 (SRY (Sex Determining Region Y)-Box 5, L-SOX5, MGC35153) (PE)

Cat. Num. AAA6187737

• Gene Names: SOX5; L-SOX5; LAMSHF; L-SOX5B; L-SOX5F
• Applications: Western Blot
• Purity: Purified
• Synonyms: SOX5; Monoclonal Antibody; SOX5 (SRY (Sex Determining Region Y)-Box 5; L-SOX5; MGC35153) (PE); SRY (Sex Determining Region Y)-Box 5; MGC35153; anti-SOX5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4H8
• Specificity: Recognizes SOX5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 763

• Applicable Applications for anti-SOX5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SOX5 (NP_008871.3, 181aa-230aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SOX5 is 1 ng/ml as a capture antibody.)

Related Product Information for anti-SOX5 antibody

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-SOX5 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 23308713
• NCBI GeneID: 6660
• NCBI Accession #: NP_008871.3
• NCBI GenBank Nucleotide #: NP_008871.3
• UniProt Accession #: P35711
• NCBI Official Full Name: transcription factor SOX-5 isoform a
• NCBI Official Synonym Full Names: SRY-box transcription factor 5
• NCBI Official Symbol: SOX5
• NCBI Official Synonym Symbols: L-SOX5; LAMSHF; L-SOX5B; L-SOX5F
• NCBI Protein Information: transcription factor SOX-5
• UniProt Protein Name: Transcription factor SOX-5
• Protein Family: Transcription factor
• UniProt Gene Name: SOX5
• UniProt Entry Name: SOX5_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX5: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12p12.1

Molecular Function: protein binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; central nervous system neuron differentiation; cell fate commitment; positive regulation of chondrocyte differentiation; in utero embryonic development; cartilage development; regulation of timing of neuron differentiation; oligodendrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent