Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SORT1 Monoclonal Antibody | anti-SORT1 antibody

SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 550)

Gene Names
SORT1; NT3; Gp95; NTR3; LDLCQ6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SORT1; Monoclonal Antibody; SORT1 (Sortilin; 100kD NT Receptor; Glycoprotein 95; Gp95; Neurotensin Receptor 3; NT3; NTR3) (MaxLight 550); anti-SORT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B3
Specificity
Recognizes human SORT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SORT1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa203-300 from human SORT1 (NP_002950) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SORT1 antibody
Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
Product Categories/Family for anti-SORT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
sortilin isoform 1 preproprotein
NCBI Official Synonym Full Names
sortilin 1
NCBI Official Symbol
SORT1
NCBI Official Synonym Symbols
NT3; Gp95; NTR3; LDLCQ6
NCBI Protein Information
sortilin
UniProt Protein Name
Sortilin
Protein Family
UniProt Gene Name
SORT1
UniProt Synonym Gene Names
Gp95; NT3; NTR3
UniProt Entry Name
SORT_HUMAN

NCBI Description

This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

SORT1: Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. A common polymorphism located in a non-coding region between CELSR2 and PSRC1 alters a CEBP transcription factor binding site and is responsible for changes in hepatic expression of SORT1. Altered SORT1 expression in liver affects low density lipoprotein cholesterol levels in plasma and is associated with susceptibility to myocardial infarction. Belongs to the VPS10-related sortilin family. SORT1 subfamily.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p13.3|1p21.3-p13.1

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; nuclear membrane; cell surface; clathrin-coated vesicle; lysosomal membrane; early endosome; cytoplasmic membrane-bound vesicle; integral to membrane; coated pit; trans-Golgi network transport vesicle; perinuclear region of cytoplasm; plasma membrane; endosome membrane

Molecular Function: protein binding; nerve growth factor receptor activity; enzyme binding; nerve growth factor binding; neurotensin receptor activity, non-G-protein coupled

Biological Process: ossification; nerve growth factor receptor signaling pathway; vesicle organization and biogenesis; multicellular organismal development; endosome transport via multivesicular body sorting pathway; myotube differentiation; Golgi to endosome transport; endocytosis; response to insulin stimulus; G-protein coupled receptor protein signaling pathway; induction of apoptosis via death domain receptors; neuropeptide signaling pathway; regulation of gene expression; glucose import; endosome to lysosome transport; plasma membrane to endosome transport; negative regulation of lipoprotein lipase activity

Disease: Low Density Lipoprotein Cholesterol Level Quantitative Trait Locus 6

Research Articles on SORT1

Similar Products

Product Notes

The SORT1 sort1 (Catalog #AAA6214141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SORT1 (Sortilin, 100kD NT Receptor, Glycoprotein 95, Gp95, Neurotensin Receptor 3, NT3, NTR3) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SORT1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SORT1 sort1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SORT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.